You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
GIF
Gastric intrinsic factor

Protein Summary
Description
Promotes absorption of the essential vitamin cobalamin (Cbl) in the ileum. After interaction with CUBN, the GIF-cobalamin complex is internalized via receptor-mediated endocytosis. This gene is a member of the cobalamin transport protein family. It encodes a glycoprotein secreted by parietal cells of the gastric mucosa and is required for adequate absorption of vitamin B12. Vitamin B12 is necessary for erythrocyte maturation and mutations in this gene may lead to congenital pernicious anemia. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000257248
  • ENSP00000257248
  • ENSG00000134812

Symbol
  • IFMH
  • IF
  • GIF
  • INF
  • IFMH
  • TCN3
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
cell type or tissue
0.7
cellular component
0.68
pathway
0.58
small molecule perturbation
0.52
cell line
0.5


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1600.11   (req: < 5)
Gene RIFs: 13   (req: <= 3)
Antibodies: 254   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1600.11   (req: >= 5)
Gene RIFs: 13   (req: > 3)
Antibodies: 254   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 4
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (3)
1 – 3 of 3
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Gene Ontology Terms (10)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Protein-Protein Interactions (50)
1 – 10 of 50
FBXO2
Tbio
Novelty: 0.03751923
p_int: 0.975502876
p_ni: 0.024495792
p_wrong: 0.000001332
Score: 0.214
Data Source: BioPlex,STRINGDB
GALNT5
Tbio
Family: Enzyme
Novelty: 0.19311337
p_int: 0.845733285
p_ni: 0.154266715
Score: 0.692
Data Source: BioPlex,STRINGDB
CUBN
Tbio
Novelty: 0.00667892
Score: 0.997
Data Source: Reactome,STRINGDB
AMN
Tbio
Novelty: 0.04256182
Score: 0.978
Data Source: Reactome,STRINGDB
TCN1
Tbio
Novelty: 0.00420205
Score: 0.919
Data Source: STRINGDB
PRSS1
Tclin
Family: Enzyme
Novelty: 0.00182538
Score: 0.9
Data Source: STRINGDB
GAST
Tbio
Novelty: 0.00012434
Score: 0.708
Data Source: STRINGDB
CD320
Tbio
Novelty: 0.03078608
Score: 0.64
Data Source: STRINGDB
MTR
Tbio
Family: Enzyme
Novelty: 0.00105146
Score: 0.634
Data Source: STRINGDB
C1R
Tclin
Novelty: 0.00294403
Score: 0.629
Data Source: STRINGDB
Publication Statistics
PubMed Score  1600.11

PubMed score by year
PubTator Score  554.33

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAWFALYLLSLLWATAGTSTQTQSSCSVPSAQEPLVNGIQVLMENSVTSSAYPNPSILIAMNLAGAYNLK
1-70
AQKLLTYQLMSSDNNDLTIGQLGLTIMALTSSCRDPGDKVSILQRQMENWAPSSPNAEASAFYGPSLAIL
70-140
ALCQKNSEATLPIAVRFAKTLLANSSPFNVDTGAMATLALTCMYNKIPVGSEEGYRSLFGQVLKDIVEKI
140-210
SMKIKDNGIIGDIYSTGLAMQALSVTPEPSKKEWNCKKTTDMILNEIKQGKFHNPMSIAQILPSLKGKTY
210-280
LDVPQVTCSPDHEVQPTLPSNPGPGPTSASNITVIYTINNQLRGVELLFNETINVSVKSGSVLLVVLEEA
280-350
QRKNPMFKFETTMTSWGLVVSSINNIAENVNHKTYWQFLSGVTPLNEGVADYIPFNHEHITANFTQY
350-417
MAWFALYLLSLLWATAGTSTQTQSSCSVPSAQEPLVNGIQVLMENSVTSSAYPNPSILIAMNLAGAYNLKAQKLLTYQLMSSDNNDLTIGQLGLTIMALTSSCRDPGDKVSILQRQMENWAPSSPNAEASAFYGPSLAILALCQKNSEATLPIAVRFAKTLLANSSPFNVDTGAMATLALTCMYNKIPVGSEEGYRSLFGQVLKDIVEKISMKIKDNGIIGDIYSTGLAMQALSVTPEPSKKEWNCKKTTDMILNEIKQGKFHNPMSIAQILPSLKGKTYLDVPQVTCSPDHEVQPTLPSNPGPGPTSASNITVIYTINNQLRGVELLFNETINVSVKSGSVLLVVLEEAQRKNPMFKFETTMTSWGLVVSSINNIAENVNHKTYWQFLSGVTPLNEGVADYIPFNHEHITANFTQY