You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
DSG1
Desmoglein-1

Protein Summary
Description
Component of intercellular desmosome junctions. Involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion. This gene encodes a member of the desmoglein protein subfamily. Desmogleins, along with desmocollins, are cadherin-like transmembrane glycoproteins that are major components of the desmosome. Desmosomes are cell-cell junctions that help resist shearing forces and are found in high concentrations in cells subject to mechanical stress. This gene is found in a cluster with other desmoglein family members on chromosome 18. The encoded protein has been identified as a target of auto-antibodies in the autoimmune skin blistering disease pemphigus foliaceus. Disruption of this gene has also been associated with the skin diseases palmoplantar keratoderma and erythroderma. [provided by RefSeq, Feb 2015]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000257192
  • ENSP00000257192
  • ENSG00000134760
  • ENST00000462981
  • ENSP00000462666

Symbol
  • CDHF4
  • DG1
  • DSG
  • CDHF4
  • EPKHE
  • PPKS1
  • SPPK1
  • EPKHIA
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein complex
1
interacting protein
0.98
protein domain
0.92
gene perturbation
0.76
cellular component
0.74


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 595.75   (req: < 5)
Gene RIFs: 55   (req: <= 3)
Antibodies: 733   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 595.75   (req: >= 5)
Gene RIFs: 55   (req: > 3)
Antibodies: 733   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 13
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (19)
Apoptosis (R-HSA-109581)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 11
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Apoptosis
Reactome
Apoptotic cleavage of cell adhesion proteins
Reactome
Apoptotic cleavage of cellular proteins
Reactome
Apoptotic execution phase
Reactome
Developmental Biology
Name
Explore in Pharos
Explore in Source
Apoptosis
Apoptotic cleavage of cell adhesion proteins
Apoptotic cleavage of cellular proteins
Apoptotic execution phase
Developmental Biology
Gene Ontology Terms (22)
Items per page:
10
1 – 3 of 3
GO Term
Evidence
Assigned by
Inferred from Physical Interaction (IPI)
BHF-UCL
Non-traceable Author Statement (NAS)
UniProtKB
Non-traceable Author Statement (NAS)
UniProtKB
Protein-Protein Interactions (112)
1 – 10 of 112
CCDC51
Tdark
Novelty: 1.55555556
p_int: 0.936203192
p_ni: 0.063796808
Score: 0.175
Data Source: BioPlex,STRINGDB
PI4KA
Tchem
Family: Kinase
Novelty: 0.02976615
p_int: 0.904551138
p_ni: 0.095448862
Data Source: BioPlex
TBC1D22B
Tbio
Novelty: 6
p_int: 0.869865587
p_ni: 0.130134413
Data Source: BioPlex
VAV1
Tchem
Novelty: 0.00223848
p_int: 0.828215187
p_ni: 0.171784813
Score: 0.221
Data Source: BioPlex,STRINGDB
CFAP298
Tbio
Novelty: 0.03483309
p_int: 0.819776528
p_ni: 0.180223471
Score: 0.161
Data Source: BioPlex,STRINGDB
PKP1
Tbio
Novelty: 0.01427015
Score: 0.993
Data Source: STRINGDB
PKP2
Tbio
Novelty: 0.00658515
Score: 0.992
Data Source: STRINGDB
DSP
Tbio
Novelty: 0.00098564
Score: 0.992
Data Source: STRINGDB
PKP3
Tbio
Novelty: 0.03295269
Score: 0.991
Data Source: STRINGDB
JUP
Tbio
Novelty: 0.01122537
Score: 0.985
Data Source: STRINGDB
Publication Statistics
PubMed Score  595.75

PubMed score by year
PubTator Score  526.2

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MDWSFFRVVAMLFIFLVVVEVNSEFRIQVRDYNTKNGTIKWHSIRRQKREWIKFAAACREGEDNSKRNPI
1-70
AKIHSDCAANQQVTYRISGVGIDQPPYGIFVINQKTGEINITSIVDREVTPFFIIYCRALNSMGQDLERP
70-140
LELRVRVLDINDNPPVFSMATFAGQIEENSNANTLVMILNATDADEPNNLNSKIAFKIIRQEPSDSPMFI
140-210
INRNTGEIRTMNNFLDREQYGQYALAVRGSDRDGGADGMSAECECNIKILDVNDNIPYMEQSSYTIEIQE
210-280
NTLNSNLLEIRVIDLDEEFSANWMAVIFFISGNEGNWFEIEMNERTNVGILKVVKPLDYEAMQSLQLSIG
280-350
VRNKAEFHHSIMSQYKLKASAISVTVLNVIEGPVFRPGSKTYVVTGNMGSNDKVGDFVATDLDTGRPSTT
350-420
VRYVMGNNPADLLAVDSRTGKLTLKNKVTKEQYNMLGGKYQGTILSIDDNLQRTCTGTININIQSFGNDD
420-490
RTNTEPNTKITTNTGRQESTSSTNYDTSTTSTDSSQVYSSEPGNGAKDLLSDNVHFGPAGIGLLIMGFLV
490-560
LGLVPFLMICCDCGGAPRSAAGFEPVPECSDGAIHSWAVEGPQPEPRDITTVIPQIPPDNANIIECIDNS
560-630
GVYTNEYGGREMQDLGGGERMTGFELTEGVKTSGMPEICQEYSGTLRRNSMRECREGGLNMNFMESYFCQ
630-700
KAYAYADEDEGRPSNDCLLIYDIEGVGSPAGSVGCCSFIGEDLDDSFLDTLGPKFKKLADISLGKESYPD
700-770
LDPSWPPQSTEPVCLPQETEPVVSGHPPISPHFGTTTVISESTYPSGPGVLHPKPILDPLGYGNVTVTES
770-840
YTTSDTLKPSVHVHDNRPASNVVVTERVVGPISGADLHGMLEMPDLRDGSNVIVTERVIAPSSSLPTSLT
840-910
IHHPRESSNVVVTERVIQPTSGMIGSLSMHPELANAHNVIVTERVVSGAGVTGISGTTGISGGIGSSGLV
910-980
GTSMGAGSGALSGAGISGGGIGLSSLGGTASIGHMRSSSDHHFNQTIGSASPSTARSRITKYSTVQYSK
980-1049
MDWSFFRVVAMLFIFLVVVEVNSEFRIQVRDYNTKNGTIKWHSIRRQKREWIKFAAACREGEDNSKRNPIAKIHSDCAANQQVTYRISGVGIDQPPYGIFVINQKTGEINITSIVDREVTPFFIIYCRALNSMGQDLERPLELRVRVLDINDNPPVFSMATFAGQIEENSNANTLVMILNATDADEPNNLNSKIAFKIIRQEPSDSPMFIINRNTGEIRTMNNFLDREQYGQYALAVRGSDRDGGADGMSAECECNIKILDVNDNIPYMEQSSYTIEIQENTLNSNLLEIRVIDLDEEFSANWMAVIFFISGNEGNWFEIEMNERTNVGILKVVKPLDYEAMQSLQLSIGVRNKAEFHHSIMSQYKLKASAISVTVLNVIEGPVFRPGSKTYVVTGNMGSNDKVGDFVATDLDTGRPSTTVRYVMGNNPADLLAVDSRTGKLTLKNKVTKEQYNMLGGKYQGTILSIDDNLQRTCTGTININIQSFGNDDRTNTEPNTKITTNTGRQESTSSTNYDTSTTSTDSSQVYSSEPGNGAKDLLSDNVHFGPAGIGLLIMGFLVLGLVPFLMICCDCGGAPRSAAGFEPVPECSDGAIHSWAVEGPQPEPRDITTVIPQIPPDNANIIECIDNSGVYTNEYGGREMQDLGGGERMTGFELTEGVKTSGMPEICQEYSGTLRRNSMRECREGGLNMNFMESYFCQKAYAYADEDEGRPSNDCLLIYDIEGVGSPAGSVGCCSFIGEDLDDSFLDTLGPKFKKLADISLGKESYPDLDPSWPPQSTEPVCLPQETEPVVSGHPPISPHFGTTTVISESTYPSGPGVLHPKPILDPLGYGNVTVTESYTTSDTLKPSVHVHDNRPASNVVVTERVVGPISGADLHGMLEMPDLRDGSNVIVTERVIAPSSSLPTSLTIHHPRESSNVVVTERVIQPTSGMIGSLSMHPELANAHNVIVTERVVSGAGVTGISGTTGISGGIGSSGLVGTSMGAGSGALSGAGISGGGIGLSSLGGTASIGHMRSSSDHHFNQTIGSASPSTARSRITKYSTVQYSK