You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
LAMTOR5
Ragulator complex protein LAMTOR5

Protein Summary
Description
As part of the Ragulator complex it is involved in amino acid sensing and activation of mTORC1, a signaling complex promoting cell growth in response to growth factors, energy levels, and amino acids. Activated by amino acids through a mechanism involving the lysosomal V-ATPase, the Ragulator functions as a guanine nucleotide exchange factor activating the small GTPases Rag. Activated Ragulator and Rag GTPases function as a scaffold recruiting mTORC1 to lysosomes where it is in turn activated. When complexed to BIRC5, interferes with apoptosome assembly, preventing recruitment of pro-caspase-9 to oligomerized APAF1, thereby selectively suppressing apoptosis initiated via the mitochondrial/cytochrome c pathway. Down-regulates hepatitis B virus (HBV) replication. This gene encodes a protein that specifically complexes with the C-terminus of hepatitis B virus X protein (HBx). The function of this protein is to negatively regulate HBx activity and thus to alter the replication life cycle o ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000602318
  • ENSP00000473439
  • ENSG00000134248

Symbol
  • HBXIP
  • XIP
  • XIP
  • HBXIP
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
histone modification site profile
0.87
biological process
0.76
transcription factor binding site profile
0.73
cellular component
0.68
kinase perturbation
0.66


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 179.45   (req: < 5)
Gene RIFs: 55   (req: <= 3)
Antibodies: 131   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 179.45   (req: >= 5)
Gene RIFs: 55   (req: > 3)
Antibodies: 131   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 10
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (10)
1 – 5 of 10
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (18)
Autophagy (R-HSA-9612973)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 16
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Autophagy
Reactome
Cellular responses to external stimuli
Reactome
Energy dependent regulation of mTOR by LKB1-AMPK
Reactome
Gene expression (Transcription)
Reactome
Generic Transcription Pathway
Name
Explore in Pharos
Explore in Source
Autophagy
Cellular responses to external stimuli
Energy dependent regulation of mTOR by LKB1-AMPK
Gene expression (Transcription)
Generic Transcription Pathway
Gene Ontology Terms (14)
Items per page:
10
1 – 4 of 4
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Traceable Author Statement (TAS)
Reactome
Protein-Protein Interactions (118)
1 – 10 of 118
RRAGA
Tbio
Novelty: 0.02277032
p_int: 0.999999983
p_ni: 1e-9
p_wrong: 1.6e-8
Score: 0.999
Data Source: BioPlex,STRINGDB
RRAGD
Tbio
Novelty: 0.08337222
p_int: 0.999999936
p_ni: 6.4e-8
Score: 0.999
Data Source: BioPlex,STRINGDB
ITPA
Tbio
Family: Enzyme
Novelty: 0.00285702
p_int: 0.999999905
p_ni: 9.5e-8
Data Source: BioPlex
SLC38A9
Tbio
Family: Transporter
Novelty: 0.11535293
p_int: 0.999996127
p_ni: 0.000002762
p_wrong: 0.000001111
Score: 0.999
Data Source: BioPlex,STRINGDB
LAMTOR4
Tdark
Novelty: 0.52565707
p_int: 0.999994887
p_ni: 0.000005109
p_wrong: 5e-9
Score: 0.999
Data Source: BioPlex,STRINGDB
RRAGC
Tbio
Novelty: 0.02924575
p_int: 0.999993852
p_ni: 0.000006148
Score: 0.999
Data Source: BioPlex,STRINGDB
UBP1
Tbio
Family: TF
Novelty: 0.01787931
p_int: 0.999988787
p_ni: 0.000011191
p_wrong: 2.3e-8
Data Source: BioPlex
LAMTOR2
Tbio
Novelty: 0.07173356
p_int: 0.999976012
p_ni: 0.000023988
Score: 0.999
Data Source: BioPlex,STRINGDB
BORCS5
Tdark
Novelty: 0.88002186
p_int: 0.999969107
p_ni: 0.000030888
p_wrong: 5e-9
Data Source: BioPlex
STK38
Tbio
Family: Kinase
Novelty: 0.04129184
p_int: 0.999942954
p_ni: 0.000057045
p_wrong: 1e-9
Data Source: BioPlex
Publication Statistics
PubMed Score  179.45

PubMed score by year
PubTator Score  51.51

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAAKLTSDPTDIPVVCLESD
1-70
NGNIMIQKHDGITVAVHKMAS
70-91
MEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAAKLTSDPTDIPVVCLESDNGNIMIQKHDGITVAVHKMAS