You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
TSHB
Thyrotropin subunit beta

Protein Summary
Description
Indispensable for the control of thyroid structure and metabolism. The four human glycoprotein hormones chorionic gonadotropin (CG), luteinizing hormone (LH), follicle stimulating hormone (FSH), and thyroid stimulating hormone (TSH) are dimers consisting of alpha and beta subunits that are associated noncovalently. The alpha subunits of these hormones are identical, however, their beta chains are unique and confer biological specificity. Thyroid stimulating hormone functions in the control of thyroid structure and metabolism. The protein encoded by this gene is the beta subunit of thyroid stimulating hormone. Mutations in this gene are associated with congenital central and secondary hypothyroidism and Hashimoto's thyroiditis. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, May 2013]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000256592
  • ENSP00000256592
  • ENSG00000134200
  • ENST00000369517
  • ENSP00000358530

Symbol
  • TSH-B
  • TSH-BETA
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
chemical
0.91
gene perturbation
0.86
tissue sample
0.68
tissue
0.67
protein domain
0.58


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 460.78   (req: < 5)
Gene RIFs: 35   (req: <= 3)
Antibodies: 962   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 460.78   (req: >= 5)
Gene RIFs: 35   (req: > 3)
Antibodies: 962   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 9
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (113)
Class A/1 (Rhodopsin-like receptors) (R-HSA-373076)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 15
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Class A/1 (Rhodopsin-like receptors)
Reactome
G alpha (s) signalling events
Reactome
GPCR downstream signalling
Reactome
GPCR ligand binding
Reactome
Glycoprotein hormones
Name
Explore in Pharos
Explore in Source
Class A/1 (Rhodopsin-like receptors)
G alpha (s) signalling events
GPCR downstream signalling
GPCR ligand binding
Glycoprotein hormones
Gene Ontology Terms (12)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Traceable Author Statement (TAS)
ProtInc
Protein-Protein Interactions (190)
1 – 10 of 190
ERC1
Tbio
Novelty: 0.01056581
p_int: 0.999999923
p_ni: 7.4e-8
p_wrong: 3e-9
Score: 0.187
Data Source: BioPlex,STRINGDB
SMCHD1
Tbio
Novelty: 0.00627532
p_int: 0.999998895
p_ni: 5.37e-7
p_wrong: 5.67e-7
Score: 0.345
Data Source: BioPlex,STRINGDB
EPDR1
Tbio
Novelty: 0.05021948
p_int: 0.999900394
p_ni: 0.000099355
p_wrong: 2.51e-7
Score: 0.532
Data Source: BioPlex,STRINGDB
ASB1
Tdark
Novelty: 0.09316254
p_int: 0.999764358
p_ni: 0.000056837
p_wrong: 0.000178805
Score: 0.237
Data Source: BioPlex,STRINGDB
RICTOR
Tbio
Novelty: 0.0008751
p_int: 0.998527851
p_ni: 0.001472148
p_wrong: 1e-9
Data Source: BioPlex
TINAG
Tbio
Novelty: 0.04045398
p_int: 0.998508912
p_ni: 0.001391366
p_wrong: 0.000099722
Score: 0.544
Data Source: BioPlex,STRINGDB
CNTNAP3
Tdark
Novelty: 0.28305555
p_int: 0.988026933
p_ni: 0.011973067
Data Source: BioPlex
SP3
Tbio
Family: TF
Novelty: 0.00293235
p_int: 0.942704118
p_ni: 0.038813955
p_wrong: 0.018481928
Score: 0.381
Data Source: BioPlex,STRINGDB
PRMT3
Tchem
Family: Epigenetic
Novelty: 0.03998365
p_int: 0.933820244
p_ni: 0.066178901
p_wrong: 8.55e-7
Score: 0.163
Data Source: BioPlex,STRINGDB
FKBP14
Tbio
Family: Enzyme
Novelty: 0.01784516
p_int: 0.899469511
p_ni: 0.084839847
p_wrong: 0.015690642
Data Source: BioPlex
Publication Statistics
PubMed Score  460.78

PubMed score by year
PubTator Score  189.68

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MTALFLMSMLFGLTCGQAMSFCIPTEYTMHIERRECAYCLTINTTICAGYCMTRDINGKLFLPKYALSQD
1-70
VCTYRDFIYRTVEIPGCPLHVAPYFSYPVALSCKCGKCNTDYSDCIHEAIKTNYCTKPQKSYLVGFSV
70-138
MTALFLMSMLFGLTCGQAMSFCIPTEYTMHIERRECAYCLTINTTICAGYCMTRDINGKLFLPKYALSQDVCTYRDFIYRTVEIPGCPLHVAPYFSYPVALSCKCGKCNTDYSDCIHEAIKTNYCTKPQKSYLVGFSV