You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
KRAS
GTPase KRas

Protein Summary
Description
Ras proteins bind GDP/GTP and possess intrinsic GTPase activity. Plays an important role in the regulation of cell proliferation (PubMed:23698361, PubMed:22711838). Plays a role in promoting oncogenic events by inducing transcriptional silencing of tumor suppressor genes (TSGs) in colorectal cancer (CRC) cells in a ZNF304-dependent manner (PubMed:24623306). This gene, a Kirsten ras oncogene homolog from the mammalian ras gene family, encodes a protein that is a member of the small GTPase superfamily. A single amino acid substitution is responsible for an activating mutation. The transforming protein that results is implicated in various malignancies, including lung adenocarcinoma, mucinous adenoma, ductal carcinoma of the pancreas and colorectal carcinoma. Alternative splicing leads to variants encoding two isoforms that differ in the C-terminal region. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000256078
  • ENSP00000256078
  • ENSG00000133703
  • ENST00000311936
  • ENSP00000308495

Symbol
  • KRAS2
  • RASK2
  • NS
  • NS3
  • CFC2
  • RALD
  • K-Ras
  • KRAS1
  • KRAS2
  • RASK2
  • KI-RAS
  • C-K-RAS
  • K-RAS2A
  • K-RAS2B
  • K-RAS4A
  • K-RAS4B
  • c-Ki-ras2
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0.99
disease
0.99
kinase perturbation
0.99
phenotype
0.98
transcription factor perturbation
0.97


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 5062.45   (req: < 5)
Gene RIFs: 1937   (req: <= 3)
Antibodies: 754   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 5062.45   (req: >= 5)
Gene RIFs: 1937   (req: > 3)
Antibodies: 754   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 36
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 1
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Active Ligands (1)
1 – 1 of 1
lonafarnib
chemical structure image
Protein Data Bank (101)
1 – 5 of 101
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (373)
Activated NTRK2 signals through FRS2 and FRS3 (R-HSA-9028731)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 129
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Activated NTRK2 signals through FRS2 and FRS3
Reactome
Activated NTRK2 signals through RAS
Reactome
Activated NTRK3 signals through RAS
Reactome
Activation of NMDA receptors and postsynaptic events
Reactome
Activation of RAS in B cells
Name
Explore in Pharos
Explore in Source
Activated NTRK2 signals through FRS2 and FRS3
Activated NTRK2 signals through RAS
Activated NTRK3 signals through RAS
Activation of NMDA receptors and postsynaptic events
Activation of RAS in B cells
Gene Ontology Terms (44)
Items per page:
10
1 – 7 of 7
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
MGI
Inferred from Physical Interaction (IPI)
IntAct
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (760)
1 – 10 of 760
RIN1
Tbio
Novelty: 0.02228321
p_int: 0.999999965
p_ni: 2e-9
p_wrong: 3.3e-8
Score: 0.956
Data Source: BioPlex,STRINGDB
BRAF
Tclin
Family: Kinase
Novelty: 0.00382184
p_int: 0.999983793
p_ni: 1.04e-7
p_wrong: 0.000016103
Score: 0.997
Data Source: BioPlex,Reactome,STRINGDB
PIK3CA
Tclin
Family: Kinase
Novelty: 0.00077082
Score: 0.998
Data Source: STRINGDB
EGFR
Tclin
Family: Kinase
Novelty: 0.0000974
Score: 0.998
Data Source: Reactome,STRINGDB
NRAS
Tchem
Family: Enzyme
Novelty: 0.00085585
Score: 0.996
Data Source: STRINGDB
RAF1
Tclin
Family: Kinase
Novelty: 0.00165174
Score: 0.995
Data Source: Reactome,STRINGDB
HRAS
Tchem
Family: Enzyme
Novelty: 0.00008788
Score: 0.995
Data Source: STRINGDB
PIK3CG
Tclin
Family: Kinase
Novelty: 0.00107389
Score: 0.993
Data Source: STRINGDB
SOS1
Tbio
Novelty: 0.00388471
Score: 0.993
Data Source: Reactome,STRINGDB
ERBB2
Tclin
Family: Kinase
Novelty: 0.00004664
Score: 0.991
Data Source: Reactome,STRINGDB
Publication Statistics
PubMed Score  5062.45

PubMed score by year
PubTator Score  8235.48

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQ
1-70
YMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIP
70-140
FIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGCVKIKKCIIM
140-189
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGCVKIKKCIIM