You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
NTS
Neurotensin/neuromedin N

Protein Summary
Description
Neurotensin may play an endocrine or paracrine role in the regulation of fat metabolism. It causes contraction of smooth muscle. This gene encodes a common precursor for two peptides, neuromedin N and neurotensin. Neurotensin is a secreted tridecapeptide, which is widely distributed throughout the central nervous system, and may function as a neurotransmitter or a neuromodulator. It may be involved in dopamine-associated pathophysiological events, in the maintenance of gut structure and function, and in the regulation of fat metabolism. Neurotensin also exhibits antimicrobial activity against bacteria and fungi. Tissue-specific processing may lead to the formation in some tissues of larger forms of neuromedin N and neurotensin. The large forms may represent more stable peptides that are also biologically active. [provided by RefSeq, Oct 2014]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000256010
  • ENSP00000256010
  • ENSG00000133636

Symbol
  • NN
  • NT
  • NT/N
  • NTS1
  • NMN-125
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological term
0.68
gene perturbation
0.68
chemical
0.64
disease
0.64
small molecule perturbation
0.59


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 3599.51   (req: < 5)
Gene RIFs: 67   (req: <= 3)
Antibodies: 282   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 3599.51   (req: >= 5)
Gene RIFs: 67   (req: > 3)
Antibodies: 282   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 6
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (9)
1 – 5 of 9
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (9)
Class A/1 (Rhodopsin-like receptors) (R-HSA-373076)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 7
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Class A/1 (Rhodopsin-like receptors)
Reactome
G alpha (q) signalling events
Reactome
GPCR downstream signalling
Reactome
GPCR ligand binding
Reactome
Peptide ligand-binding receptors
Name
Explore in Pharos
Explore in Source
Class A/1 (Rhodopsin-like receptors)
G alpha (q) signalling events
GPCR downstream signalling
GPCR ligand binding
Peptide ligand-binding receptors
Gene Ontology Terms (9)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (317)
1 – 10 of 317
NTSR1
Tchem
Family: GPCR
Novelty: 0.00096519
Score: 0.999
Data Source: Reactome,STRINGDB
NTSR2
Tchem
Family: GPCR
Novelty: 0.00855606
Score: 0.998
Data Source: Reactome,STRINGDB
TAC1
Tbio
Novelty: 0.00007711
Score: 0.988
Data Source: STRINGDB
CCK
Tbio
Novelty: 0.00013779
Score: 0.985
Data Source: STRINGDB
NPS
Tbio
Novelty: 0.00011983
Score: 0.984
Data Source: STRINGDB
GRP
Tbio
Novelty: 0.00039263
Score: 0.983
Data Source: STRINGDB
GAST
Tbio
Novelty: 0.00012434
Score: 0.977
Data Source: STRINGDB
NLN
Tbio
Family: Enzyme
Novelty: 0.00186409
Score: 0.975
Data Source: Reactome,STRINGDB
MLN
Tbio
Novelty: 0.00089433
Score: 0.972
Data Source: STRINGDB
KNG1
Tchem
Novelty: 0.00008572
Score: 0.971
Data Source: STRINGDB
Publication Statistics
PubMed Score  3599.51

PubMed score by year
PubTator Score  912.77

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MMAGMKIQLVCMLLLAFSSWSLCSDSEEEMKALEADFLTNMHTSKISKAHVPSWKMTLLNVCSLVNNLNS
1-70
PAEETGEVHEEELVARRKLPTALDGFSLEAMLTIYQLHKICHSRAFQHWELIQEDILDTGNDKNGKEEVI
70-140
KRKIPYILKRQLYENKPRRPYILKRDSYYY
140-170
MMAGMKIQLVCMLLLAFSSWSLCSDSEEEMKALEADFLTNMHTSKISKAHVPSWKMTLLNVCSLVNNLNSPAEETGEVHEEELVARRKLPTALDGFSLEAMLTIYQLHKICHSRAFQHWELIQEDILDTGNDKNGKEEVIKRKIPYILKRQLYENKPRRPYILKRDSYYY