You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
ACTR3B
Actin-related protein 3B

Protein Summary
Description
Plays a role in the organization of the actin cytoskeleton. May function as ATP-binding component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks. May decrease the metastatic potential of tumors. This gene encodes a member of the actin-related proteins (ARP), which form multiprotein complexes and share 35-55% amino acid identity with conventional actin. The protein encoded by this gene may have a regulatory role in the actin cytoskeleton and induce cell-shape change and motility. Pseudogenes of this gene are located on chromosomes 2, 4, 10, 16, 22 and Y. Alternative splicing results in multiple transcript variants and protein isoforms. [provided by RefSeq, Jul 2012]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000256001
  • ENSP00000256001
  • ENSG00000133627
  • ENST00000377776
  • ENSP00000367007
  • ENST00000397282
  • ENSP00000380452

Symbol
  • ARP11
  • ARP4
  • ARP11
  • ARP3BETA
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
0.81
transcription factor binding site profile
0.69
virus perturbation
0.68
tissue sample
0.67
transcription factor
0.64


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 10.55   (req: < 5)
Gene RIFs: 2   (req: <= 3)
Antibodies: 175   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 10.55   (req: >= 5)
Gene RIFs: 2   (req: > 3)
Antibodies: 175   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 3
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (7)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (93)
1 – 10 of 93
ARPC1A
Tbio
Novelty: 0.10861673
p_int: 0.999999707
p_ni: 2.93e-7
Score: 0.981
Data Source: BioPlex,STRINGDB
ARPC1B
Tbio
Novelty: 0.05202587
p_int: 0.9999681
p_ni: 0.0000319
Score: 0.98
Data Source: BioPlex,STRINGDB
ARPC3
Tbio
Novelty: 0.0428612
p_int: 0.999944054
p_ni: 0.000055946
Score: 0.987
Data Source: BioPlex,STRINGDB
ACTR2
Tbio
Novelty: 0.01032806
p_int: 0.99988571
p_ni: 0.00011429
Score: 0.984
Data Source: BioPlex,STRINGDB
ARPC5
Tbio
Novelty: 0.08405086
p_int: 0.999885491
p_ni: 0.000114509
Score: 0.969
Data Source: BioPlex,STRINGDB
ARPC2
Tbio
Novelty: 0.04147436
p_int: 0.999697726
p_ni: 0.000302274
Score: 0.987
Data Source: BioPlex,STRINGDB
CHURC1
Tbio
Novelty: 0.00494162
p_int: 0.998993393
p_ni: 6.3e-8
p_wrong: 0.001006544
Score: 0.286
Data Source: BioPlex,STRINGDB
OSBPL3
Tbio
Novelty: 0.13671998
p_int: 0.997591035
p_ni: 0.002407333
p_wrong: 0.000001632
Score: 0.223
Data Source: BioPlex,STRINGDB
ACTR3
Tbio
Novelty: 0.03429716
p_int: 0.996287125
p_ni: 0.003712875
Score: 0.911
Data Source: BioPlex,STRINGDB
ARPC5L
Tdark
Novelty: 0.72650824
p_int: 0.995238855
p_ni: 0.004761145
Score: 0.985
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  10.55

PubMed score by year
PubTator Score  2.26

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAGSLPPCVVDCGTGYTKLGYAGNTEPQFIIPSCIAIRESAKVVDQAQRRVLRGVDDLDFFIGDEAIDKP
1-70
TYATKWPIRHGIIEDWDLMERFMEQVVFKYLRAEPEDHYFLMTEPPLNTPENREYLAEIMFESFNVPGLY
70-140
IAVQAVLALAASWTSRQVGERTLTGIVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRE
140-210
REVGIPPEQSLETAKAIKEKYCYICPDIVKEFAKYDVDPRKWIKQYTGINAINQKKFVIDVGYERFLGPE
210-280
IFFHPEFANPDFMESISDVVDEVIQNCPIDVRRPLYKNVVLSGGSTMFRDFGRRLQRDLKRVVDARLRLS
280-350
EELSGGRIKPKPVEVQVVTHHMQRYAVWFGGSMLASTPEFFQVCHTKKDYEEYGPSICRHNPVFGVMS
350-418
MAGSLPPCVVDCGTGYTKLGYAGNTEPQFIIPSCIAIRESAKVVDQAQRRVLRGVDDLDFFIGDEAIDKPTYATKWPIRHGIIEDWDLMERFMEQVVFKYLRAEPEDHYFLMTEPPLNTPENREYLAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGIVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLREREVGIPPEQSLETAKAIKEKYCYICPDIVKEFAKYDVDPRKWIKQYTGINAINQKKFVIDVGYERFLGPEIFFHPEFANPDFMESISDVVDEVIQNCPIDVRRPLYKNVVLSGGSTMFRDFGRRLQRDLKRVVDARLRLSEELSGGRIKPKPVEVQVVTHHMQRYAVWFGGSMLASTPEFFQVCHTKKDYEEYGPSICRHNPVFGVMS