You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
SERPINF1
Pigment epithelium-derived factor

Protein Summary
Description
Neurotrophic protein; induces extensive neuronal differentiation in retinoblastoma cells. Potent inhibitor of angiogenesis. As it does not undergo the S (stressed) to R (relaxed) conformational transition characteristic of active serpins, it exhibits no serine protease inhibitory activity. This gene encodes a member of the serpin family that does not display the serine protease inhibitory activity shown by many of the other serpin proteins. The encoded protein is secreted and strongly inhibits angiogenesis. In addition, this protein is a neurotrophic factor involved in neuronal differentiation in retinoblastoma cells. Mutations in this gene were found in individuals with osteogenesis imperfecta, type VI. [provided by RefSeq, Aug 2016]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000254722
  • ENSP00000254722
  • ENSG00000132386

Symbol
  • PEDF
  • OI6
  • OI12
  • PEDF
  • EPC-1
  • PIG35
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0.97
disease perturbation
0.96
small molecule perturbation
0.94
gene perturbation
0.83
transcription factor perturbation
0.8


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 145.79   (req: < 5)
Gene RIFs: 247   (req: <= 3)
Antibodies: 574   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 145.79   (req: >= 5)
Gene RIFs: 247   (req: > 3)
Antibodies: 574   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 23
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Gene Ontology Terms (31)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Protein-Protein Interactions (66)
1 – 10 of 66
L3MBTL2
Tbio
Family: Epigenetic
Novelty: 0.13882316
p_int: 0.999999328
p_ni: 6.72e-7
Score: 0.163
Data Source: BioPlex,STRINGDB
MMP19
Tbio
Family: Enzyme
Novelty: 0.01308297
p_int: 0.997270474
p_ni: 0.002729526
Score: 0.156
Data Source: BioPlex,STRINGDB
ADAM18
Tdark
Family: Enzyme
Novelty: 0.24489796
p_int: 0.996841634
p_ni: 0.003156973
p_wrong: 0.000001394
Data Source: BioPlex
KLHL8
Tdark
Novelty: 1.00719424
p_int: 0.962686326
p_ni: 0.037133173
p_wrong: 0.000180501
Score: 0.237
Data Source: BioPlex,STRINGDB
TUBA4A
Tchem
Novelty: 0.02626744
p_int: 0.920037199
p_ni: 0.079962801
Data Source: BioPlex
HSPA5
Tchem
Novelty: 0.00051387
p_int: 0.844783113
p_ni: 0.155216887
Score: 0.17
Data Source: BioPlex,STRINGDB
LRP6
Tbio
Novelty: 0.00325624
Score: 0.901
Data Source: STRINGDB
LRP5
Tbio
Novelty: 0.00102638
Score: 0.884
Data Source: STRINGDB
VEGFA
Tclin
Novelty: 0.00004909
Score: 0.819
Data Source: STRINGDB
IFITM5
Tbio
Novelty: 0.02057351
Score: 0.788
Data Source: STRINGDB
Publication Statistics
PubMed Score  145.79

PubMed score by year
PubTator Score  543.98

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MQALVLLLCIGALLGHSSCQNPASPPEEGSPDPDSTGALVEEEDPFFKVPVNKLAAAVSNFGYDLYRVRS
1-70
STSPTTNVLLSPLSVATALSALSLGAEQRTESIIHRALYYDLISSPDIHGTYKELLDTVTAPQKNLKSAS
70-140
RIVFEKKLRIKSSFVAPLEKSYGTRPRVLTGNPRLDLQEINNWVQAQMKGKLARSTKEIPDEISILLLGV
140-210
AHFKGQWVTKFDSRKTSLEDFYLDEERTVRVPMMSDPKAVLRYGLDSDLSCKIAQLPLTGSMSIIFFLPL
210-280
KVTQNLTLIEESLTSEFIHDIDRELKTVQAVLTVPKLKLSYEGEVTKSLQEMKLQSLFDSPDFSKITGKP
280-350
IKLTQVEHRAGFEWNEDGAGTTPSPGLQPAHLTFPLDYHLNQPFIFVLRDTDTGALLFIGKILDPRGP
350-418
MQALVLLLCIGALLGHSSCQNPASPPEEGSPDPDSTGALVEEEDPFFKVPVNKLAAAVSNFGYDLYRVRSSTSPTTNVLLSPLSVATALSALSLGAEQRTESIIHRALYYDLISSPDIHGTYKELLDTVTAPQKNLKSASRIVFEKKLRIKSSFVAPLEKSYGTRPRVLTGNPRLDLQEINNWVQAQMKGKLARSTKEIPDEISILLLGVAHFKGQWVTKFDSRKTSLEDFYLDEERTVRVPMMSDPKAVLRYGLDSDLSCKIAQLPLTGSMSIIFFLPLKVTQNLTLIEESLTSEFIHDIDRELKTVQAVLTVPKLKLSYEGEVTKSLQEMKLQSLFDSPDFSKITGKPIKLTQVEHRAGFEWNEDGAGTTPSPGLQPAHLTFPLDYHLNQPFIFVLRDTDTGALLFIGKILDPRGP