You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
BARX1
Homeobox protein BarH-like 1

Protein Summary
Description
Transcription factor, which is involved in craniofacial development, in odontogenesis and in stomach organogenesis. May have a role in the differentiation of molars from incisors. Plays a role in suppressing endodermal Wnt activity (By similarity). Binds to a regulatory module of the NCAM promoter. This gene encodes a member of the Bar subclass of homeobox transcription factors. Studies of the mouse and chick homolog suggest the encoded protein may play a role in developing teeth and craniofacial mesenchyme of neural crest origin. The protein may also be associated with differentiation of stomach epithelia. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000253968
  • ENSP00000253968
  • ENSG00000131668
  • ENST00000401724
  • ENSP00000385613
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein domain
0.73
gene perturbation
0.7
PubMedID
0.64
cell type or tissue
0.63
biological process
0.62


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 36.76   (req: < 5)
Gene RIFs: 4   (req: <= 3)
Antibodies: 229   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 36.76   (req: >= 5)
Gene RIFs: 4   (req: > 3)
Antibodies: 229   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 13
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Gene Ontology Terms (14)
Items per page:
10
1 – 4 of 4
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Sequence Alignment (ISA)
NTNU_SB
Non-traceable Author Statement (NAS)
UniProtKB
Protein-Protein Interactions (43)
1 – 10 of 43
BMP4
Tchem
Novelty: 0.00057391
Score: 0.909
Data Source: STRINGDB
FGF8
Tbio
Novelty: 0.00182042
Score: 0.736
Data Source: STRINGDB
LHX8
Tbio
Family: TF
Novelty: 0.0239848
Score: 0.735
Data Source: STRINGDB
LHX6
Tbio
Family: TF
Novelty: 0.02582227
Score: 0.692
Data Source: STRINGDB
PAX9
Tbio
Family: TF
Novelty: 0.00768556
Score: 0.69
Data Source: STRINGDB
TBX22
Tbio
Family: TF
Novelty: 0.00885604
Score: 0.604
Data Source: STRINGDB
OSR2
Tbio
Family: TF
Novelty: 0.03425236
Score: 0.597
Data Source: STRINGDB
SFRP2
Tbio
Novelty: 0.00605883
Score: 0.591
Data Source: STRINGDB
SFRP1
Tchem
Novelty: 0.00359719
Score: 0.578
Data Source: STRINGDB
FOXF1
Tbio
Family: TF
Novelty: 0.01072169
Score: 0.555
Data Source: STRINGDB
Publication Statistics
PubMed Score  36.76

PubMed score by year
PubTator Score  11.04

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MQRPGEPGAARFGPPEGCADHRPHRYRSFMIEEILTEPPGPKGAAPAAAAAAAGELLKFGVQALLAARPF
1-70
HSHLAVLKAEQAAVFKFPLAPLGCSGLSSALLAAGPGLPGAAGAPHLPLELQLRGKLEAAGPGEPGTKAK
70-140
KGRRSRTVFTELQLMGLEKRFEKQKYLSTPDRIDLAESLGLSQLQVKTWYQNRRMKWKKIVLQGGGLESP
140-210
TKPKGRPKKNSIPTSEQLTEQERAKDAEKPAEVPGEPSDRSRED
210-254
MQRPGEPGAARFGPPEGCADHRPHRYRSFMIEEILTEPPGPKGAAPAAAAAAAGELLKFGVQALLAARPFHSHLAVLKAEQAAVFKFPLAPLGCSGLSSALLAAGPGLPGAAGAPHLPLELQLRGKLEAAGPGEPGTKAKKGRRSRTVFTELQLMGLEKRFEKQKYLSTPDRIDLAESLGLSQLQVKTWYQNRRMKWKKIVLQGGGLESPTKPKGRPKKNSIPTSEQLTEQERAKDAEKPAEVPGEPSDRSRED