You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
GATA5
Transcription factor GATA-5

Protein Summary
Description
Transcription factor required during cardiovascular development (PubMed:23289003). Plays an important role in the transcriptional program(s) that underlies smooth muscle cell diversity (By similarity). Binds to the functionally important CEF-1 nuclear protein binding site in the cardiac-specific slow/cardiac troponin C transcriptional enhancer (PubMed:25543888). The protein encoded by this gene is a transcription factor that contains two GATA-type zinc fingers. The encoded protein is known to bind to hepatocyte nuclear factor-1alpha (HNF-1alpha), and this interaction is essential for cooperative activation of the intestinal lactase-phlorizin hydrolase promoter. In other organisms, similar proteins may be involved in the establishment of cardiac smooth muscle cell diversity. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000252997
  • ENSP00000252997
  • ENSG00000130700

Symbol
  • CHTD5
  • GATAS
  • bB379O24.1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
0.76
protein domain
0.73
cell type or tissue
0.7
biological process
0.68
PubMedID
0.62


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 93.83   (req: < 5)
Gene RIFs: 36   (req: <= 3)
Antibodies: 246   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 93.83   (req: >= 5)
Gene RIFs: 36   (req: > 3)
Antibodies: 246   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 19
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (2)
Factors involved in megakaryocyte development and platelet production (R-HSA-983231)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 2 of 2
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Factors involved in megakaryocyte development and platelet production
Reactome
Hemostasis
Name
Explore in Pharos
Explore in Source
Factors involved in megakaryocyte development and platelet production
Hemostasis
Gene Ontology Terms (22)
Items per page:
10
1 – 7 of 7
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
MGI
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Sequence or structural Similarity (ISS)
BHF-UCL
Inferred from Sequence Alignment (ISA)
NTNU_SB
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (89)
1 – 10 of 89
GATA6
Tbio
Family: TF
Novelty: 0.00338656
Score: 0.955
Data Source: STRINGDB
ZFPM2
Tbio
Family: TF
Novelty: 0.01483815
Score: 0.946
Data Source: STRINGDB
ZFPM1
Tbio
Family: TF
Novelty: 0.00277855
Score: 0.936
Data Source: STRINGDB
GATA1
Tbio
Family: TF
Novelty: 0.0009412
Score: 0.925
Data Source: STRINGDB
GATA2
Tbio
Family: TF
Novelty: 0.00178271
Score: 0.924
Data Source: STRINGDB
GATA4
Tbio
Family: TF
Novelty: 0.00115226
Score: 0.924
Data Source: STRINGDB
GATA3
Tbio
Family: TF
Novelty: 0.00087325
Score: 0.923
Data Source: STRINGDB
NKX2-5
Tbio
Family: TF
Novelty: 0.00147966
Score: 0.835
Data Source: STRINGDB
LCT
Tbio
Family: Enzyme
Novelty: 0.00221691
Score: 0.804
Data Source: STRINGDB
HNF1A
Tbio
Family: TF
Novelty: 0.00145707
Score: 0.781
Data Source: STRINGDB
Publication Statistics
PubMed Score  93.83

PubMed score by year
PubTator Score  64.21

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MYQSLALAASPRQAAYADSGSFLHAPGAGSPMFVPPARVPSMLSYLSGCEPSPQPPELAARPGWAQTATA
1-70
DSSAFGPGSPHPPAAHPPGATAFPFAHSPSGPGSGGSAGGRDGSAYQGALLPREQFAAPLGRPVGTSYSA
70-140
TYPAYVSPDVAQSWTAGPFDGSVLHGLPGRRPTFVSDFLEEFPGEGRECVNCGALSTPLWRRDGTGHYLC
140-210
NACGLYHKMNGVNRPLVRPQKRLSSSRRAGLCCTNCHTTNTTLWRRNSEGEPVCNACGLYMKLHGVPRPL
210-280
AMKKESIQTRKRKPKTIAKARGSSGSTRNASASPSAVASTDSSAATSKAKPSLASPVCPGPSMAPQASGQ
280-350
EDDSLAPGHLEFKFEPEDFAFPSTAPSPQAGLRGALRQEAWCALALA
350-397
MYQSLALAASPRQAAYADSGSFLHAPGAGSPMFVPPARVPSMLSYLSGCEPSPQPPELAARPGWAQTATADSSAFGPGSPHPPAAHPPGATAFPFAHSPSGPGSGGSAGGRDGSAYQGALLPREQFAAPLGRPVGTSYSATYPAYVSPDVAQSWTAGPFDGSVLHGLPGRRPTFVSDFLEEFPGEGRECVNCGALSTPLWRRDGTGHYLCNACGLYHKMNGVNRPLVRPQKRLSSSRRAGLCCTNCHTTNTTLWRRNSEGEPVCNACGLYMKLHGVPRPLAMKKESIQTRKRKPKTIAKARGSSGSTRNASASPSAVASTDSSAATSKAKPSLASPVCPGPSMAPQASGQEDDSLAPGHLEFKFEPEDFAFPSTAPSPQAGLRGALRQEAWCALALA