You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
ADAMTS2
A disintegrin and metalloproteinase with thrombospondin motifs 2

Protein Summary
Description
Cleaves the propeptides of type I and II collagen prior to fibril assembly. Does not act on type III collagen. May also play a role in development that is independent of its role in collagen biosynthesis. This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The encoded preproprotein is proteolytically processed to generate the mature procollagen N-proteinase. This proteinase excises the N-propeptide of the fibrillar procollagens types I-III and type V. Mutations in this gene cause Ehlers-Danlos syndrome type VIIC, a recessively inherited connective-tissue disorder. Alternative splicing results in multiple transcrip ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000251582
  • ENSP00000251582
  • ENSG00000087116
  • ENST00000274609
  • ENSP00000274609
  • ENST00000639107
  • ENSP00000492365
  • ENSG00000283802
  • ENST00000639986
  • ENSP00000492346

Symbol
  • PCINP
  • PCPNI
  • NPI
  • PNPI
  • PCINP
  • PCPNI
  • PCI-NP
  • PC I-NP
  • ADAM-TS2
  • ADAMTS-2
  • ADAMTS-3
  • EDSDERMS
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein domain
0.97
PubMedID
0.8
transcription factor perturbation
0.74
transcription factor
0.64
tissue sample
0.62


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 354.71   (req: < 5)
Gene RIFs: 11   (req: <= 3)
Antibodies: 171   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 354.71   (req: >= 5)
Gene RIFs: 11   (req: > 3)
Antibodies: 171   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 9
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (11)
Collagen biosynthesis and modifying enzymes (R-HSA-1650814)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 11
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Collagen biosynthesis and modifying enzymes
Reactome
Collagen formation
Reactome
Defective B3GALTL causes Peters-plus syndrome (PpS)
Reactome
Disease
Reactome
Diseases associated with O-glycosylation of proteins
Name
Explore in Pharos
Explore in Source
Collagen biosynthesis and modifying enzymes
Collagen formation
Defective B3GALTL causes Peters-plus syndrome (PpS)
Disease
Diseases associated with O-glycosylation of proteins
Protein-Protein Interactions (125)
1 – 10 of 125
PSCA
Tbio
Novelty: 0.00370639
p_int: 0.999351524
p_ni: 0.000648476
Data Source: BioPlex
TMPRSS11B
Tdark
Family: Enzyme
Novelty: 1.71428571
p_int: 0.998177247
p_ni: 0.001769055
p_wrong: 0.000053698
Data Source: BioPlex
DKKL1
Tbio
Novelty: 0.00579782
p_int: 0.997562389
p_ni: 0.002437611
Data Source: BioPlex
ST8SIA4
Tbio
Family: Enzyme
Novelty: 0.00575428
p_int: 0.997467115
p_ni: 0.002532879
p_wrong: 6e-9
Data Source: BioPlex
RLN1
Tbio
Novelty: 0.05712331
p_int: 0.996227381
p_ni: 0.003772601
p_wrong: 1.8e-8
Data Source: BioPlex
SLAMF1
Tbio
Novelty: 0.00121506
p_int: 0.994154883
p_ni: 0.005844974
p_wrong: 1.43e-7
Data Source: BioPlex
CLEC12A
Tbio
Novelty: 0.02175617
p_int: 0.991124967
p_ni: 0.008585459
p_wrong: 0.000289575
Data Source: BioPlex
TCTN2
Tdark
Novelty: 0.19568118
p_int: 0.988760527
p_ni: 0.010871736
p_wrong: 0.000367737
Data Source: BioPlex
LYPD4
Tbio
Novelty: 0.00522455
p_int: 0.981293457
p_ni: 0.018706539
p_wrong: 4e-9
Data Source: BioPlex
CD1B
Tbio
Novelty: 0.00152228
p_int: 0.9737494
p_ni: 0.026250598
p_wrong: 2e-9
Data Source: BioPlex
Publication Statistics
PubMed Score  354.71

PubMed score by year
PubTator Score  56

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MDPPAGAARRLLCPALLLLLLLLPPPLLPPPPPPANARLAAAADPPGGPLGHGAERILAVPVRTDAQGRL
1-70
VSHVVSAATSRAGVRARRAAPVRTPSFPGGNEEEPGSHLFYNVTVFGRDLHLRLRPNARLVAPGATMEWQ
70-140
GEKGTTRVEPLLGSCLYVGDVAGLAEASSVALSNCDGLAGLIRMEEEEFFIEPLEKGLAAQEAEQGRVHV
140-210
VYRRPPTSPPLGGPQALDTGASLDSLDSLSRALGVLEEHANSSRRRARRHAADDDYNIEVLLGVDDSVVQ
210-280
FHGKEHVQKYLLTLMNIVNEIYHDESLGAHINVVLVRIILLSYGKSMSLIEIGNPSQSLENVCRWAYLQQ
280-350
KPDTGHDEYHDHAIFLTRQDFGPSGMQGYAPVTGMCHPVRSCTLNHEDGFSSAFVVAHETGHVLGMEHDG
350-420
QGNRCGDEVRLGSIMAPLVQAAFHRFHWSRCSQQELSRYLHSYDCLLDDPFAHDWPALPQLPGLHYSMNE
420-490
QCRFDFGLGYMMCTAFRTFDPCKQLWCSHPDNPYFCKTKKGPPLDGTMCAPGKHCFKGHCIWLTPDILKR
490-560
DGSWGAWSPFGSCSRTCGTGVKFRTRQCDNPHPANGGRTCSGLAYDFQLCSRQDCPDSLADFREEQCRQW
560-630
DLYFEHGDAQHHWLPHEHRDAKERCHLYCESRETGEVVSMKRMVHDGTRCSYKDAFSLCVRGDCRKVGCD
630-700
GVIGSSKQEDKCGVCGGDNSHCKVVKGTFTRSPKKHGYIKMFEIPAGARHLLIQEVDATSHHLAVKNLET
700-770
GKFILNEENDVDASSKTFIAMGVEWEYRDEDGRETLQTMGPLHGTITVLVIPVGDTRVSLTYKYMIHEDS
770-840
LNVDDNNVLEEDSVVYEWALKKWSPCSKPCGGGSQFTKYGCRRRLDHKMVHRGFCAALSKPKAIRRACNP
840-910
QECSQPVWVTGEWEPCSQTCGRTGMQVRSVRCIQPLHDNTTRSVHAKHCNDARPESRRACSRELCPGRWR
910-980
AGPWSQCSVTCGNGTQERPVLCRTADDSFGICQEERPETARTCRLGPCPRNISDPSKKSYVVQWLSRPDP
980-1050
DSPIRKISSKGHCQGDKSIFCRMEVLSRYCSIPGYNKLCCKSCNLYNNLTNVEGRIEPPPGKHNDIDVFM
1050-1120
PTLPVPTVAMEVRPSPSTPLEVPLNASSTNATEDHPETNAVDEPYKIHGLEDEVQPPNLIPRRPSPYEKT
1120-1190
RNQRIQELIDEMRKKEMLGKF
1190-1211
MDPPAGAARRLLCPALLLLLLLLPPPLLPPPPPPANARLAAAADPPGGPLGHGAERILAVPVRTDAQGRLVSHVVSAATSRAGVRARRAAPVRTPSFPGGNEEEPGSHLFYNVTVFGRDLHLRLRPNARLVAPGATMEWQGEKGTTRVEPLLGSCLYVGDVAGLAEASSVALSNCDGLAGLIRMEEEEFFIEPLEKGLAAQEAEQGRVHVVYRRPPTSPPLGGPQALDTGASLDSLDSLSRALGVLEEHANSSRRRARRHAADDDYNIEVLLGVDDSVVQFHGKEHVQKYLLTLMNIVNEIYHDESLGAHINVVLVRIILLSYGKSMSLIEIGNPSQSLENVCRWAYLQQKPDTGHDEYHDHAIFLTRQDFGPSGMQGYAPVTGMCHPVRSCTLNHEDGFSSAFVVAHETGHVLGMEHDGQGNRCGDEVRLGSIMAPLVQAAFHRFHWSRCSQQELSRYLHSYDCLLDDPFAHDWPALPQLPGLHYSMNEQCRFDFGLGYMMCTAFRTFDPCKQLWCSHPDNPYFCKTKKGPPLDGTMCAPGKHCFKGHCIWLTPDILKRDGSWGAWSPFGSCSRTCGTGVKFRTRQCDNPHPANGGRTCSGLAYDFQLCSRQDCPDSLADFREEQCRQWDLYFEHGDAQHHWLPHEHRDAKERCHLYCESRETGEVVSMKRMVHDGTRCSYKDAFSLCVRGDCRKVGCDGVIGSSKQEDKCGVCGGDNSHCKVVKGTFTRSPKKHGYIKMFEIPAGARHLLIQEVDATSHHLAVKNLETGKFILNEENDVDASSKTFIAMGVEWEYRDEDGRETLQTMGPLHGTITVLVIPVGDTRVSLTYKYMIHEDSLNVDDNNVLEEDSVVYEWALKKWSPCSKPCGGGSQFTKYGCRRRLDHKMVHRGFCAALSKPKAIRRACNPQECSQPVWVTGEWEPCSQTCGRTGMQVRSVRCIQPLHDNTTRSVHAKHCNDARPESRRACSRELCPGRWRAGPWSQCSVTCGNGTQERPVLCRTADDSFGICQEERPETARTCRLGPCPRNISDPSKKSYVVQWLSRPDPDSPIRKISSKGHCQGDKSIFCRMEVLSRYCSIPGYNKLCCKSCNLYNNLTNVEGRIEPPPGKHNDIDVFMPTLPVPTVAMEVRPSPSTPLEVPLNASSTNATEDHPETNAVDEPYKIHGLEDEVQPPNLIPRRPSPYEKTRNQRIQELIDEMRKKEMLGKF