You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
DAZL
Deleted in azoospermia-like

Protein Summary
Description
RNA-binding protein, which is essential for gametogenesis in both males and females. Plays a central role during spermatogenesis. Acts by binding to the 3'-UTR of mRNA, specifically recognizing GUU triplets, and thereby regulating the translation of key transcripts (By similarity). The DAZ (Deleted in AZoospermia) gene family encodes potential RNA binding proteins that are expressed in prenatal and postnatal germ cells of males and females. The protein encoded by this gene is localized to the nucleus and cytoplasm of fetal germ cells and to the cytoplasm of developing oocytes. In the testis, this protein is localized to the nucleus of spermatogonia but relocates to the cytoplasm during meiosis where it persists in spermatids and spermatozoa. Transposition and amplification of this autosomal gene during primate evolution gave rise to the DAZ gene cluster on the Y chromosome. Mutations in this gene have been linked to severe spermatogenic failure and infertility in males. Two transcript ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000250863
  • ENSP00000250863
  • ENSG00000092345
  • ENST00000399444
  • ENSP00000382373

Symbol
  • DAZH
  • DAZL1
  • DAZLA
  • SPGYLA
  • DAZH
  • DAZL1
  • DAZLA
  • SPGYLA
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
cell type or tissue
0.76
co-expressed gene
0.65
biological process
0.62
molecular function
0.6
cellular component
0.57


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 197.49   (req: < 5)
Gene RIFs: 43   (req: <= 3)
Antibodies: 291   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 197.49   (req: >= 5)
Gene RIFs: 43   (req: > 3)
Antibodies: 291   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 11
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (45)
Items per page:
1 – 5 of 45
Data Source
Name
Explore in Pharos
Explore in Source
WikiPathways
Ovarian Infertility Genes
WikiPathways
Ovarian Infertility Genes
WikiPathways
Ovarian Infertility Genes
WikiPathways
Ovarian Infertility Genes
WikiPathways
Ovarian Infertility Genes
Name
Explore in Pharos
Explore in Source
Ovarian Infertility Genes
Ovarian Infertility Genes
Ovarian Infertility Genes
Ovarian Infertility Genes
Ovarian Infertility Genes
Protein-Protein Interactions (136)
1 – 10 of 136
DAZAP2
Tbio
Novelty: 0.03047855
Score: 0.939
Data Source: STRINGDB
SYCE1
Tbio
Novelty: 0.07934297
Score: 0.903
Data Source: STRINGDB
SYCE2
Tdark
Novelty: 0.24565206
Score: 0.901
Data Source: STRINGDB
STRA8
Tbio
Novelty: 0.01091211
Score: 0.897
Data Source: STRINGDB
PUM2
Tbio
Novelty: 0.02673355
Score: 0.897
Data Source: STRINGDB
DDX4
Tbio
Family: Enzyme
Novelty: 0.0102628
Score: 0.878
Data Source: STRINGDB
DND1
Tbio
Novelty: 0.03567644
Score: 0.857
Data Source: STRINGDB
SYCP3
Tbio
Novelty: 0.00585649
Score: 0.853
Data Source: STRINGDB
NANOS3
Tbio
Novelty: 0.0228214
Score: 0.844
Data Source: STRINGDB
NANOS2
Tbio
Novelty: 0.01977029
Score: 0.817
Data Source: STRINGDB
Publication Statistics
PubMed Score  197.49

PubMed score by year
PubTator Score  104.6

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSTANPETPNSTISREASTQSSSAATSQGYILPEGKIMPNTVFVGGIDVRMDETEIRSFFARYGSVKEVK
1-70
IITDRTGVSKGYGFVSFFNDVDVQKIVESQINFHGKKLKLGPAIRKQNLCAYHVQPRPLVFNHPPPPQFQ
70-140
NVWTNPNTETYMQPTTTMNPITQYVQAYPTYPNSPVQVITGYQLPVYNYQMPPQWPVGEQRSYVVPPAYS
140-210
AVNYHCNEVDPGAEVVPNECSVHEATPPSGNGPQKKSVDRSIQTVVSCLFNPENRLRNSVVTQDDYFKDK
210-280
RVHHFRRSRAMLKSV
280-295
MSTANPETPNSTISREASTQSSSAATSQGYILPEGKIMPNTVFVGGIDVRMDETEIRSFFARYGSVKEVKIITDRTGVSKGYGFVSFFNDVDVQKIVESQINFHGKKLKLGPAIRKQNLCAYHVQPRPLVFNHPPPPQFQNVWTNPNTETYMQPTTTMNPITQYVQAYPTYPNSPVQVITGYQLPVYNYQMPPQWPVGEQRSYVVPPAYSAVNYHCNEVDPGAEVVPNECSVHEATPPSGNGPQKKSVDRSIQTVVSCLFNPENRLRNSVVTQDDYFKDKRVHHFRRSRAMLKSV