Protein Summary
Cellular oxygen sensor that catalyzes, under normoxic conditions, the post-translational formation of 4-hydroxyproline in hypoxia-inducible factor (HIF) alpha proteins. Hydroxylates a specific proline found in each of the oxygen-dependent degradation (ODD) domains (N-terminal, NODD, and C-terminal, CODD) of HIF1A. Also hydroxylates HIF2A. Has a preference for the CODD site for both HIF1A and HIF2A. Hydroxylation on the NODD site by EGLN3 appears to require prior hydroxylation on the CODD site. Hydroxylated HIFs are then targeted for proteasomal degradation via the von Hippel-Lindau ubiquitination complex. Under hypoxic conditions, the hydroxylation reaction is attenuated allowing HIFs to escape degradation resulting in their translocation to the nucleus, heterodimerization with HIF1B, and increased expression of hypoxy-inducible genes. EGLN3 is the most important isozyme in limiting physiological activation of HIFs (particularly HIF2A) in hypoxia. Also hydroxylates PKM in hypoxia, limi ...more
- ENST00000250457
- ENSP00000250457
- ENSG00000129521
- PHD3
- HIFPH3
- HIFP4H3
Most Knowledge About | Knowledge Value
(0 to 1 scale) | ||
---|---|---|---|
gene perturbation | 0.96 | ||
PubMedID | 0.95 | ||
kinase perturbation | 0.91 | ||
microRNA | 0.83 | ||
biological process | 0.79 | ||
IDG Development Level Summary
These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 126.64 (req: < 5)
Gene RIFs: 68 (req: <= 3)
Antibodies: 440 (req: <= 50)
These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 126.64 (req: >= 5)
Gene RIFs: 68 (req: > 3)
Antibodies: 440 (req: > 50)
- OR - satisfy the following criterion:
Gene Ontology Terms: 13
Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions
Active Ligands: 82
Target has at least one approved drug - AND - satisfies the preceding conditions
Active Drug: 1
Approved Drugs (1)
1 – 1 of 1
Active Ligands (82)
1 – 10 of 82
Pathways (31)
Reactome (4)
KEGG (3)
PathwayCommons (4)
WikiPathways (20)
Click on a row in the table to change the structure displayed.
Items per page:
1 – 4 of 4
Data Source | Name | Explore in Pharos | Explore in Source | ||
---|---|---|---|---|---|
Reactome | Cellular response to hypoxia | ||||
Reactome | Cellular responses to external stimuli | ||||
Reactome | Cellular responses to stress | ||||
Reactome | Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha | ||||
Name | Explore in Pharos | Explore in Source | ||
---|---|---|---|---|
Cellular response to hypoxia | ||||
Cellular responses to external stimuli | ||||
Cellular responses to stress | ||||
Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha | ||||
Gene Ontology Terms (17)
Functions (4)
Components (4)
Processes (9)
Items per page:
10
1 – 4 of 4
GO Term | Evidence | Assigned by | ||
---|---|---|---|---|
Inferred from Direct Assay (IDA) | MGI | |||
Inferred from Direct Assay (IDA) | FlyBase | |||
Inferred from Electronic Annotation (IEA) | InterPro | |||
Inferred from Electronic Annotation (IEA) | UniProtKB-KW | |||
Protein-Protein Interactions (158)
1 – 10 of 158
SBDS
Novelty: 0.00526647
p_int: 0.999984597
p_ni: 0.000015403
Data Source: BioPlex
CCT6B
Novelty: 0.35608309
p_int: 0.993218455
p_ni: 0.006781544
p_wrong: 1e-9
Data Source: BioPlex
ACACA
Family: Enzyme
Novelty: 0.00198949
p_int: 0.984992108
p_ni: 0.015007892
Data Source: BioPlex
HIF1A
Family: TF
Novelty: 0.00031917
Score: 0.991
Data Source: Reactome,STRINGDB
EPAS1
Novelty: 0.00460751
Score: 0.983
Data Source: Reactome,STRINGDB
VHL
Family: Enzyme
Novelty: 0.00323188
Score: 0.982
Data Source: Reactome,STRINGDB
HIF3A
Novelty: 0.00260684
Score: 0.976
Data Source: Reactome,STRINGDB
ELOC
Novelty: 0.0146568
Score: 0.954
Data Source: Reactome,STRINGDB
OS9
Novelty: 0.01598375
Score: 0.952
Data Source: STRINGDB
CUL2
Novelty: 0.00892549
Score: 0.946
Data Source: Reactome,STRINGDB
Publication Statistics
PubMed Score 126.64
PubMed score by year
PubTator Score 110.98
PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MPLGHIMRLDLEKIALEYIVPCLHEVGFCYLDNFLGEVVGDCVLERVKQLHCTGALRDGQLAGPRAGVSK
1-70
RHLRGDQITWIGGNEEGCEAISFLLSLIDRLVLYCGSRLGKYYVKERSKAMVACYPGNGTGYVRHVDNPN
70-140
GDGRCITCIYYLNKNWDAKLHGGILRIFPEGKSFIADVEPIFDRLLFFWSDRRNPHEVQPSYATRYAMTV
140-210
WYFDAEERAEAKKKFRNLTRKTESALTED
210-239
MPLGHIMRLDLEKIALEYIVPCLHEVGFCYLDNFLGEVVGDCVLERVKQLHCTGALRDGQLAGPRAGVSKRHLRGDQITWIGGNEEGCEAISFLLSLIDRLVLYCGSRLGKYYVKERSKAMVACYPGNGTGYVRHVDNPNGDGRCITCIYYLNKNWDAKLHGGILRIFPEGKSFIADVEPIFDRLLFFWSDRRNPHEVQPSYATRYAMTVWYFDAEERAEAKKKFRNLTRKTESALTED
Find similar targets by: