You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
YEATS4
YEATS domain-containing protein 4

Protein Summary
Description
Component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. NuA4 may also play a direct role in DNA repair when recruited to sites of DNA damage. The protein encoded by this gene is found in the nucleoli. It has high sequence homology to human MLLT1, and yeast and human MLLT3 proteins. Both MLLT1 and MLLT3 proteins belong to a class of transcription factors, indicating that the encoded protein might also represent a transcription factor. This protein i ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000247843
  • ENSP00000247843
  • ENSG00000127337

Symbol
  • GAS41
  • YAF9
  • GAS41
  • NUBI-1
  • 4930573H17Rik
  • B230215M10Rik
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
kinase perturbation
0.88
histone modification site profile
0.85
cellular component
0.74
interacting protein
0.72
biological process
0.69


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 37.36   (req: < 5)
Gene RIFs: 17   (req: <= 3)
Antibodies: 367   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 37.36   (req: >= 5)
Gene RIFs: 17   (req: > 3)
Antibodies: 367   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 10
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (4)
1 – 4 of 4
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (9)
Activation of the TFAP2 (AP-2) family of transcription factors (R-HSA-8866907)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 8
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Activation of the TFAP2 (AP-2) family of transcription factors
Reactome
Chromatin modifying enzymes
Reactome
Chromatin organization
Reactome
Gene expression (Transcription)
Reactome
Generic Transcription Pathway
Name
Explore in Pharos
Explore in Source
Activation of the TFAP2 (AP-2) family of transcription factors
Chromatin modifying enzymes
Chromatin organization
Gene expression (Transcription)
Generic Transcription Pathway
Protein-Protein Interactions (206)
1 – 10 of 206
SNX16
Tbio
Novelty: 0.19735156
p_int: 0.999999454
p_ni: 5.42e-7
p_wrong: 3e-9
Score: 0.224
Data Source: BioPlex,STRINGDB
KAT5
Tchem
Family: Epigenetic
Novelty: 0.00465028
p_int: 0.999998513
p_ni: 0.000001487
Score: 0.991
Data Source: BioPlex,STRINGDB
WEE1
Tchem
Family: Kinase
Novelty: 0.00181917
p_int: 0.999997788
p_ni: 0.000002032
p_wrong: 1.8e-7
Score: 0.211
Data Source: BioPlex,STRINGDB
ACTR6
Tbio
Novelty: 0.10608703
p_int: 0.999996365
p_ni: 0.000003635
Score: 0.943
Data Source: BioPlex,STRINGDB
VPS72
Tbio
Novelty: 0.0079733
p_int: 0.999995821
p_ni: 0.000004179
Score: 0.994
Data Source: BioPlex,STRINGDB
SRCAP
Tbio
Family: Enzyme
Novelty: 0.02725076
p_int: 0.999993828
p_ni: 0.000006172
Score: 0.922
Data Source: BioPlex,STRINGDB
MEAF6
Tbio
Novelty: 0.2575873
p_int: 0.99999257
p_ni: 0.00000743
Score: 0.994
Data Source: BioPlex,STRINGDB
EPC1
Tbio
Novelty: 0.0580351
p_int: 0.999989612
p_ni: 0.000010387
p_wrong: 1e-9
Score: 0.996
Data Source: BioPlex,STRINGDB
MBTD1
Tdark
Family: Epigenetic
Novelty: 0.22350152
p_int: 0.999979832
p_ni: 0.000020168
Score: 0.849
Data Source: BioPlex,STRINGDB
ING3
Tbio
Family: Epigenetic
Novelty: 0.02294983
p_int: 0.999973038
p_ni: 0.000026962
Score: 0.99
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  37.36

PubMed score by year
PubTator Score  19.36

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MFKRMAEFGPDSGGRVKGVTIVKPIVYGNVARYFGKKREEDGHTHQWTVYVKPYRNEDMSAYVKKIQFKL
1-70
HESYGNPLRVVTKPPYEITETGWGEFEIIIKIFFIDPNERPVTLYHLLKLFQSDTNAMLGKKTVVSEFYD
70-140
EMIFQDPTAMMQQLLTTSRQLTLGAYKHETEFAELEVKTREKLEAAKKKTSFEIAELKERLKASRETINC
140-210
LKNEIRKLEEDDQAKDI
210-227
MFKRMAEFGPDSGGRVKGVTIVKPIVYGNVARYFGKKREEDGHTHQWTVYVKPYRNEDMSAYVKKIQFKLHESYGNPLRVVTKPPYEITETGWGEFEIIIKIFFIDPNERPVTLYHLLKLFQSDTNAMLGKKTVVSEFYDEMIFQDPTAMMQQLLTTSRQLTLGAYKHETEFAELEVKTREKLEAAKKKTSFEIAELKERLKASRETINCLKNEIRKLEEDDQAKDI