You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
DSTN
Destrin

Protein Summary
Description
Actin-depolymerizing protein. Severs actin filaments (F-actin) and binds to actin monomers (G-actin). Acts in a pH-independent manner. The product of this gene belongs to the actin-binding proteins ADF family. This family of proteins is responsible for enhancing the turnover rate of actin in vivo. This gene encodes the actin depolymerizing protein that severs actin filaments (F-actin) and binds to actin monomers (G-actin). Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000246069
  • ENSP00000246069
  • ENSG00000125868
  • ENST00000474024
  • ENSP00000476975

Symbol
  • ACTDP
  • DSN
  • ADF
  • ACTDP
  • HEL32
  • bA462D18.2
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
disease perturbation
1
virus perturbation
1
transcription factor perturbation
0.94
transcription factor binding site profile
0.89
kinase perturbation
0.84


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 62.21   (req: < 5)
Gene RIFs: 11   (req: <= 3)
Antibodies: 349   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 62.21   (req: >= 5)
Gene RIFs: 11   (req: > 3)
Antibodies: 349   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 6
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (118)
Items per page:
1 – 5 of 118
Data Source
Name
Explore in Pharos
Explore in Source
WikiPathways
Androgen receptor signaling pathway
WikiPathways
Androgen receptor signaling pathway
WikiPathways
Androgen receptor signaling pathway
WikiPathways
Androgen receptor signaling pathway
WikiPathways
Androgen receptor signaling pathway
Name
Explore in Pharos
Explore in Source
Androgen receptor signaling pathway
Androgen receptor signaling pathway
Androgen receptor signaling pathway
Androgen receptor signaling pathway
Androgen receptor signaling pathway
Gene Ontology Terms (9)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Protein-Protein Interactions (159)
1 – 10 of 159
ACTB
Tbio
Novelty: 0.00027728
Score: 0.912
Data Source: STRINGDB
ACTG1
Tbio
Novelty: 0.00111542
Score: 0.905
Data Source: STRINGDB
WDR1
Tbio
Novelty: 0.02141132
Score: 0.872
Data Source: STRINGDB
TWF1
Tbio
Novelty: 0.06393105
Score: 0.846
Data Source: STRINGDB
RPS6
Tbio
Novelty: 0.00155552
Score: 0.831
Data Source: STRINGDB
RBM24
Tbio
Novelty: 0.05713269
Score: 0.827
Data Source: STRINGDB
LIMK1
Tchem
Family: Kinase
Novelty: 0.0046681
Score: 0.8
Data Source: STRINGDB
TPM4
Tbio
Novelty: 0.00688369
Score: 0.794
Data Source: STRINGDB
SSH1
Tbio
Family: Enzyme
Novelty: 0.02721177
Score: 0.777
Data Source: STRINGDB
LIMK2
Tchem
Family: Kinase
Novelty: 0.0180473
Score: 0.772
Data Source: STRINGDB
Publication Statistics
PubMed Score  62.21

PubMed score by year
PubTator Score  304.08

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MASGVQVADEVCRIFYDMKVRKCSTPEEIKKRKKAVIFCLSADKKCIIVEEGKEILVGDVGVTITDPFKH
1-70
FVGMLPEKDCRYALYDASFETKESRKEELMFFLWAPELAPLKSKMIYASSKDAIKKKFQGIKHECQANGP
70-140
EDLNRACIAEKLGGSLIVAFEGCPV
140-165
MASGVQVADEVCRIFYDMKVRKCSTPEEIKKRKKAVIFCLSADKKCIIVEEGKEILVGDVGVTITDPFKHFVGMLPEKDCRYALYDASFETKESRKEELMFFLWAPELAPLKSKMIYASSKDAIKKKFQGIKHECQANGPEDLNRACIAEKLGGSLIVAFEGCPV