You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
SSPN
Sarcospan

Protein Summary
Description
Component of the dystrophin-glycoprotein complex (DGC), a complex that spans the muscle plasma membrane and forms a link between the F-actin cytoskeleton and the extracellular matrix. Preferentially associates with the sarcoglycan subcomplex of the DGC. This gene encodes a member of the dystrophin-glycoprotein complex (DGC). The DGC spans the sarcolemma and is comprised of dystrophin, syntrophin, alpha- and beta-dystroglycans and sarcoglycans. The DGC provides a structural link between the subsarcolemmal cytoskeleton and the extracellular matrix of muscle cells. Two alternatively spliced transcript variants that encode different protein isoforms have been described. [provided by RefSeq, Oct 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000242729
  • ENSP00000242729
  • ENSG00000123096
  • ENST00000422622
  • ENSP00000396087
  • ENST00000540266
  • ENSP00000442893

Symbol
  • KRAG
  • KRAG
  • NSPN
  • SPN1
  • SPN2
  • DAGA5
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
cellular component
0.72
kinase perturbation
0.71
microRNA
0.67
small molecule perturbation
0.65
transcription factor perturbation
0.54


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 48.99   (req: < 5)
Gene RIFs: 13   (req: <= 3)
Antibodies: 60   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 48.99   (req: >= 5)
Gene RIFs: 13   (req: > 3)
Antibodies: 60   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 2
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (8)
Items per page:
10
1 – 6 of 6
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
LIFEdb
Traceable Author Statement (TAS)
ProtInc
Traceable Author Statement (TAS)
ProtInc
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
UniProtKB-SubCell
Inferred from Electronic Annotation (IEA)
UniProtKB-SubCell
Protein-Protein Interactions (54)
1 – 10 of 54
SGCD
Tbio
Novelty: 0.00647552
Score: 0.937
Data Source: STRINGDB
DMD
Tclin
Novelty: 0.00029078
Score: 0.934
Data Source: STRINGDB
SGCA
Tbio
Novelty: 0.00500833
Score: 0.932
Data Source: STRINGDB
UTRN
Tbio
Novelty: 0.00225431
Score: 0.929
Data Source: STRINGDB
SGCE
Tbio
Novelty: 0.00599539
Score: 0.921
Data Source: STRINGDB
SGCB
Tbio
Novelty: 0.0009261
Score: 0.92
Data Source: STRINGDB
SGCG
Tbio
Novelty: 0.00582471
Score: 0.915
Data Source: STRINGDB
SNTA1
Tbio
Novelty: 0.03034237
Score: 0.899
Data Source: STRINGDB
DAG1
Tbio
Family: Enzyme
Novelty: 0.00185637
Score: 0.884
Data Source: STRINGDB
CAV3
Tbio
Novelty: 0.00250765
Score: 0.873
Data Source: STRINGDB
Publication Statistics
PubMed Score  48.99

PubMed score by year
PubTator Score  30.22

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MGKNKQPRGQQRQGGPPAADAAGPDDMEPKKGTGAPKECGEEEPRTCCGCRFPLLLALLQLALGIAVTVV
1-70
GFLMASISSSLLVRDTPFWAGIIVCLVAYLGLFMLCVSYQVDERTCIQFSMKLLYFLLSALGLTVCVLAV
70-140
AFAAHHYSQLTQFTCETTLDSCQCKLPSSEPLSRTFVYRDVTDCTSVTGTFKLFLLIQMILNLVCGLVCL
140-210
LACFVMWKHRYQVFYVGVRICSLTASEGPQQKI
210-243
MGKNKQPRGQQRQGGPPAADAAGPDDMEPKKGTGAPKECGEEEPRTCCGCRFPLLLALLQLALGIAVTVVGFLMASISSSLLVRDTPFWAGIIVCLVAYLGLFMLCVSYQVDERTCIQFSMKLLYFLLSALGLTVCVLAVAFAAHHYSQLTQFTCETTLDSCQCKLPSSEPLSRTFVYRDVTDCTSVTGTFKLFLLIQMILNLVCGLVCLLACFVMWKHRYQVFYVGVRICSLTASEGPQQKI