You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
BHLHE41
Class E basic helix-loop-helix protein 41

Protein Summary
Description
Transcriptional repressor involved in the regulation of the circadian rhythm by negatively regulating the activity of the clock genes and clock-controlled genes. Acts as the negative limb of a novel autoregulatory feedback loop (DEC loop) which differs from the one formed by the PER and CRY transcriptional repressors (PER/CRY loop). Both these loops are interlocked as it represses the expression of PER1 and in turn is repressed by PER1/2 and CRY1/2. Represses the activity of the circadian transcriptional activator: CLOCK-ARNTL/BMAL1 heterodimer by competing for the binding to E-box elements (5'-CACGTG-3') found within the promoters of its target genes. Negatively regulates its own expression and the expression of DBP and BHLHE41/DEC2. Acts as a corepressor of RXR and the RXR-LXR heterodimers and represses the ligand-induced RXRA/B/G, NR1H3/LXRA, NR1H4 and VDR transactivation activity. This gene encodes a basic helix-loop-helix protein expressed in various tissues. The encoded protein c ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000242728
  • ENSP00000242728
  • ENSG00000123095

Symbol
  • BHLHB3
  • DEC2
  • SHARP1
  • DEC2
  • hDEC2
  • BHLHB3
  • SHARP1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
1
small molecule perturbation
0.8
transcription factor binding site profile
0.8
PubMedID
0.69
transcription factor
0.69


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 124.64   (req: < 5)
Gene RIFs: 39   (req: <= 3)
Antibodies: 367   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 124.64   (req: >= 5)
Gene RIFs: 39   (req: > 3)
Antibodies: 367   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 28
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (89)
BMAL1:CLOCK,NPAS2 activates circadian gene expression (R-HSA-1368108)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 2 of 2
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
BMAL1:CLOCK,NPAS2 activates circadian gene expression
Reactome
Circadian Clock
Name
Explore in Pharos
Explore in Source
BMAL1:CLOCK,NPAS2 activates circadian gene expression
Circadian Clock
Gene Ontology Terms (29)
Items per page:
10
1 – 10 of 17
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Physical Interaction (IPI)
BHF-UCL
Inferred from Physical Interaction (IPI)
BHF-UCL
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Sequence or structural Similarity (ISS)
BHF-UCL
Protein-Protein Interactions (64)
1 – 10 of 64
PER2
Tchem
Novelty: 0.0020454
Score: 0.999
Data Source: STRINGDB
CLOCK
Tbio
Family: TF; Epigenetic
Novelty: 0.00211154
Score: 0.994
Data Source: STRINGDB
NPAS2
Tbio
Family: TF
Novelty: 0.01102244
Score: 0.993
Data Source: STRINGDB
CRY2
Tbio
Novelty: 0.00269908
Score: 0.991
Data Source: STRINGDB
NFIL3
Tbio
Family: TF
Novelty: 0.01158727
Score: 0.987
Data Source: Reactome,STRINGDB
NR1D1
Tchem
Family: NR
Novelty: 0.00579481
Score: 0.981
Data Source: STRINGDB
ARNTL
Tbio
Family: TF
Novelty: 0.00130179
Score: 0.977
Data Source: STRINGDB
CRY1
Tchem
Novelty: 0.00172273
Score: 0.973
Data Source: STRINGDB
CSNK1E
Tchem
Family: Kinase
Novelty: 0.00998717
Score: 0.944
Data Source: STRINGDB
BHLHE40
Tbio
Family: TF
Novelty: 0.01475643
Score: 0.922
Data Source: STRINGDB
Publication Statistics
PubMed Score  124.64

PubMed score by year
PubTator Score  88.4

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MDEGIPHLQERQLLEHRDFIGLDYSSLYMCKPKRSMKRDDTKDTYKLPHRLIEKKRRDRINECIAQLKDL
1-70
LPEHLKLTTLGHLEKAVVLELTLKHLKALTALTEQQHQKIIALQNGERSLKSPIQSDLDAFHSGFQTCAK
70-140
EVLQYLSRFESWTPREPRCVQLINHLHAVATQFLPTPQLLTQQVPLSKGTGAPSAAGSAAAPCLERAGQK
140-210
LEPLAYCVPVIQRTQPSAELAAENDTDTDSGYGGEAEARPDREKGKGAGASRVTIKQEPPGEDSPAPKRM
210-280
KLDSRGGGSGGGPGGGAAAAAAALLGPDPAAAAALLRPDAALLSSLVAFGGGGGAPFPQPAAAAAPFCLP
280-350
FCFLSPSAAAAYVQPFLDKSGLEKYLYPAAAAAPFPLLYPGIPAPAAAAAAAAAAAAAAAAFPCLSSVLS
350-420
PPPEKAGAAAATLLPHEVAPLGAPHPQHPHGRTHLPFAGPREPGNPESSAQEDPSQPGKEAP
420-482
MDEGIPHLQERQLLEHRDFIGLDYSSLYMCKPKRSMKRDDTKDTYKLPHRLIEKKRRDRINECIAQLKDLLPEHLKLTTLGHLEKAVVLELTLKHLKALTALTEQQHQKIIALQNGERSLKSPIQSDLDAFHSGFQTCAKEVLQYLSRFESWTPREPRCVQLINHLHAVATQFLPTPQLLTQQVPLSKGTGAPSAAGSAAAPCLERAGQKLEPLAYCVPVIQRTQPSAELAAENDTDTDSGYGGEAEARPDREKGKGAGASRVTIKQEPPGEDSPAPKRMKLDSRGGGSGGGPGGGAAAAAAALLGPDPAAAAALLRPDAALLSSLVAFGGGGGAPFPQPAAAAAPFCLPFCFLSPSAAAAYVQPFLDKSGLEKYLYPAAAAAPFPLLYPGIPAPAAAAAAAAAAAAAAAAFPCLSSVLSPPPEKAGAAAATLLPHEVAPLGAPHPQHPHGRTHLPFAGPREPGNPESSAQEDPSQPGKEAP