Protein Classes
Protein Summary
Acts as a transcriptional activator that promotes transcription of muscle-specific target genes and plays a role in muscle differentiation, cell cycle exit and muscle atrophy. Essential for the development of functional embryonic skeletal fiber muscle differentiation. However is dispensable for postnatal skeletal muscle growth; phosphorylation by CAMK2G inhibits its transcriptional activity in respons to muscle activity. Required for the recruitment of the FACT complex to muscle-specific promoter regions, thus promoting gene expression initiation. During terminal myoblast differentiation, plays a role as a strong activator of transcription at loci with an open chromatin structure previously initiated by MYOD1. Together with MYF5 and MYOD1, co-occupies muscle-specific gene promoter core regions during myogenesis. Cooperates also with myocyte-specific enhancer factor MEF2D and BRG1-dependent recruitment of SWI/SNF chromatin-remodeling enzymes to alter chromatin structure at myogenic late ...more
- ENST00000241651
- ENSP00000241651
- ENSG00000122180
- BHLHC3
- MYF4
- MYF4
- myf-4
- bHLHc3
Most Knowledge About | Knowledge Value
(0 to 1 scale) | ||
---|---|---|---|
biological process | 0.98 | ||
molecular function | 0.95 | ||
gene perturbation | 0.65 | ||
tissue | 0.65 | ||
cellular component | 0.64 | ||
IDG Development Level Summary
These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 872 (req: < 5)
Gene RIFs: 25 (req: <= 3)
Antibodies: 1009 (req: <= 50)
These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 872 (req: >= 5)
Gene RIFs: 25 (req: > 3)
Antibodies: 1009 (req: > 50)
- OR - satisfy the following criterion:
Gene Ontology Terms: 45
Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions
Active Ligand: 0
Target has at least one approved drug - AND - satisfies the preceding conditions
Active Drug: 0
Pathways (7)
Reactome (2)
PathwayCommons (2)
WikiPathways (3)
Click on a row in the table to change the structure displayed.
Items per page:
1 – 2 of 2
Data Source | Name | Explore in Pharos | Explore in Source | ||
---|---|---|---|---|---|
Reactome | Developmental Biology | ||||
Reactome | Myogenesis | ||||
Name | Explore in Pharos | Explore in Source | ||
---|---|---|---|---|
Developmental Biology | ||||
Myogenesis | ||||
Gene Ontology Terms (49)
Functions (11)
Components (4)
Processes (34)
Items per page:
10
1 – 10 of 11
GO Term | Evidence | Assigned by | ||
---|---|---|---|---|
Inferred from Direct Assay (IDA) | NTNU_SB | |||
Inferred from Direct Assay (IDA) | NTNU_SB | |||
Inferred from Direct Assay (IDA) | NTNU_SB | |||
Inferred from Biological aspect of Ancestor (IBA) | GO_Central | |||
Inferred from Biological aspect of Ancestor (IBA) | GO_Central | |||
Inferred from Sequence or structural Similarity (ISS) | UniProtKB | |||
Inferred from Sequence or structural Similarity (ISS) | UniProtKB | |||
Inferred from Sequence or structural Similarity (ISS) | UniProtKB | |||
Inferred from Sequence or structural Similarity (ISS) | BHF-UCL | |||
Inferred from Sequence Alignment (ISA) | NTNU_SB | |||
Protein-Protein Interactions (220)
1 – 10 of 220
TCF12
Family: TF
Novelty: 0.00546341
p_int: 0.999990796
p_ni: 0.000009204
Score: 0.991
Data Source: BioPlex,STRINGDB
TCF4
Family: TF
Novelty: 0.00249816
p_int: 0.999944702
p_ni: 0.00005529
p_wrong: 8e-9
Score: 0.989
Data Source: BioPlex,STRINGDB
TCF3
Family: TF
Novelty: 0.00154157
p_int: 0.978505325
p_ni: 0.021494674
p_wrong: 1e-9
Score: 0.992
Data Source: BioPlex,Reactome,STRINGDB
NES
Novelty: 0.00038894
p_int: 0.843885118
p_ni: 0.020879581
p_wrong: 0.135235301
Score: 0.778
Data Source: BioPlex,STRINGDB
ID4
Family: TF
Novelty: 0.00570969
p_int: 0.782555675
p_ni: 0.000538307
p_wrong: 0.216906018
Score: 0.838
Data Source: BioPlex,STRINGDB
MEF2C
Family: TF
Novelty: 0.00288254
Score: 0.988
Data Source: Reactome,STRINGDB
MEF2A
Family: TF
Novelty: 0.00521515
Score: 0.988
Data Source: Reactome,STRINGDB
MEF2D
Family: TF
Novelty: 0.008552
Score: 0.98
Data Source: STRINGDB
MYOD1
Family: TF
Novelty: 0.00064991
Score: 0.947
Data Source: STRINGDB
PAX7
Family: TF
Novelty: 0.0018427
Score: 0.945
Data Source: STRINGDB
Publication Statistics
PubMed Score 872.00
PubMed score by year
PubTator Score 524.88
PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MELYETSPYFYQEPRFYDGENYLPVHLQGFEPPGYERTELTLSPEAPGPLEDKGLGTPEHCPGQCLPWAC
1-70
KVCKRKSVSVDRRRAATLREKRRLKKVNEAFEALKRSTLLNPNQRLPKVEILRSAIQYIERLQALLSSLN
70-140
QEERDLRYRGGGGPQPGVPSECSSHSASCSPEWGSALEFSANPGDHLLTADPTDAHNLHSLTSIVDSITV
140-210
EDVSVAFPDETMPN
210-224
MELYETSPYFYQEPRFYDGENYLPVHLQGFEPPGYERTELTLSPEAPGPLEDKGLGTPEHCPGQCLPWACKVCKRKSVSVDRRRAATLREKRRLKKVNEAFEALKRSTLLNPNQRLPKVEILRSAIQYIERLQALLSSLNQEERDLRYRGGGGPQPGVPSECSSHSASCSPEWGSALEFSANPGDHLLTADPTDAHNLHSLTSIVDSITVEDVSVAFPDETMPN
Find similar targets by: