You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
MYOG
Myogenin

Protein Summary
Description
Acts as a transcriptional activator that promotes transcription of muscle-specific target genes and plays a role in muscle differentiation, cell cycle exit and muscle atrophy. Essential for the development of functional embryonic skeletal fiber muscle differentiation. However is dispensable for postnatal skeletal muscle growth; phosphorylation by CAMK2G inhibits its transcriptional activity in respons to muscle activity. Required for the recruitment of the FACT complex to muscle-specific promoter regions, thus promoting gene expression initiation. During terminal myoblast differentiation, plays a role as a strong activator of transcription at loci with an open chromatin structure previously initiated by MYOD1. Together with MYF5 and MYOD1, co-occupies muscle-specific gene promoter core regions during myogenesis. Cooperates also with myocyte-specific enhancer factor MEF2D and BRG1-dependent recruitment of SWI/SNF chromatin-remodeling enzymes to alter chromatin structure at myogenic late ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000241651
  • ENSP00000241651
  • ENSG00000122180

Symbol
  • BHLHC3
  • MYF4
  • MYF4
  • myf-4
  • bHLHc3
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0.98
molecular function
0.95
gene perturbation
0.65
tissue
0.65
cellular component
0.64


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 872   (req: < 5)
Gene RIFs: 25   (req: <= 3)
Antibodies: 1009   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 872   (req: >= 5)
Gene RIFs: 25   (req: > 3)
Antibodies: 1009   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 45
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (7)
Developmental Biology (R-HSA-1266738)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 2 of 2
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Developmental Biology
Reactome
Myogenesis
Name
Explore in Pharos
Explore in Source
Developmental Biology
Myogenesis
Gene Ontology Terms (49)
Items per page:
10
1 – 10 of 11
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
NTNU_SB
Inferred from Direct Assay (IDA)
NTNU_SB
Inferred from Direct Assay (IDA)
NTNU_SB
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
BHF-UCL
Inferred from Sequence Alignment (ISA)
NTNU_SB
Protein-Protein Interactions (220)
1 – 10 of 220
TCF12
Tbio
Family: TF
Novelty: 0.00546341
p_int: 0.999990796
p_ni: 0.000009204
Score: 0.991
Data Source: BioPlex,STRINGDB
TCF4
Tbio
Family: TF
Novelty: 0.00249816
p_int: 0.999944702
p_ni: 0.00005529
p_wrong: 8e-9
Score: 0.989
Data Source: BioPlex,STRINGDB
TCF3
Tbio
Family: TF
Novelty: 0.00154157
p_int: 0.978505325
p_ni: 0.021494674
p_wrong: 1e-9
Score: 0.992
Data Source: BioPlex,Reactome,STRINGDB
NES
Tbio
Novelty: 0.00038894
p_int: 0.843885118
p_ni: 0.020879581
p_wrong: 0.135235301
Score: 0.778
Data Source: BioPlex,STRINGDB
ID4
Tbio
Family: TF
Novelty: 0.00570969
p_int: 0.782555675
p_ni: 0.000538307
p_wrong: 0.216906018
Score: 0.838
Data Source: BioPlex,STRINGDB
MEF2C
Tbio
Family: TF
Novelty: 0.00288254
Score: 0.988
Data Source: Reactome,STRINGDB
MEF2A
Tbio
Family: TF
Novelty: 0.00521515
Score: 0.988
Data Source: Reactome,STRINGDB
MEF2D
Tbio
Family: TF
Novelty: 0.008552
Score: 0.98
Data Source: STRINGDB
MYOD1
Tbio
Family: TF
Novelty: 0.00064991
Score: 0.947
Data Source: STRINGDB
PAX7
Tbio
Family: TF
Novelty: 0.0018427
Score: 0.945
Data Source: STRINGDB
Publication Statistics
PubMed Score  872.00

PubMed score by year
PubTator Score  524.88

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MELYETSPYFYQEPRFYDGENYLPVHLQGFEPPGYERTELTLSPEAPGPLEDKGLGTPEHCPGQCLPWAC
1-70
KVCKRKSVSVDRRRAATLREKRRLKKVNEAFEALKRSTLLNPNQRLPKVEILRSAIQYIERLQALLSSLN
70-140
QEERDLRYRGGGGPQPGVPSECSSHSASCSPEWGSALEFSANPGDHLLTADPTDAHNLHSLTSIVDSITV
140-210
EDVSVAFPDETMPN
210-224
MELYETSPYFYQEPRFYDGENYLPVHLQGFEPPGYERTELTLSPEAPGPLEDKGLGTPEHCPGQCLPWACKVCKRKSVSVDRRRAATLREKRRLKKVNEAFEALKRSTLLNPNQRLPKVEILRSAIQYIERLQALLSSLNQEERDLRYRGGGGPQPGVPSECSSHSASCSPEWGSALEFSANPGDHLLTADPTDAHNLHSLTSIVDSITVEDVSVAFPDETMPN