You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
SELL
L-selectin

Protein Summary
Description
Calcium-dependent lectin that mediates cell adhesion by binding to glycoproteins on neighboring cells (PubMed:12403782, PubMed:28489325, PubMed:28011641). Mediates the adherence of lymphocytes to endothelial cells of high endothelial venules in peripheral lymph nodes. Promotes initial tethering and rolling of leukocytes in endothelia (PubMed:12403782, PubMed:28011641). This gene encodes a cell surface adhesion molecule that belongs to a family of adhesion/homing receptors. The encoded protein contains a C-type lectin-like domain, a calcium-binding epidermal growth factor-like domain, and two short complement-like repeats. The gene product is required for binding and subsequent rolling of leucocytes on endothelial cells, facilitating their migration into secondary lymphoid organs and inflammation sites. Single-nucleotide polymorphisms in this gene have been associated with various diseases including immunoglobulin A nephropathy. Alternatively spliced transcript variants have been found ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000236147
  • ENSP00000236147
  • ENSG00000188404

Symbol
  • LNHR
  • LYAM1
  • TQ1
  • LAM1
  • LEU8
  • LNHR
  • LSEL
  • CD62L
  • LYAM1
  • PLNHR
  • LECAM1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein domain
0.99
biological term
0.95
gene perturbation
0.79
disease
0.76
chemical
0.75


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 3079.95   (req: < 5)
Gene RIFs: 160   (req: <= 3)
Antibodies: 1371   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 3079.95   (req: >= 5)
Gene RIFs: 160   (req: > 3)
Antibodies: 1371   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 14
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 4
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (4)
1 – 4 of 4
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (9)
Adaptive Immune System (R-HSA-1280218)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 7
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Adaptive Immune System
Reactome
Cell surface interactions at the vascular wall
Reactome
Hemostasis
Reactome
Immune System
Reactome
Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Name
Explore in Pharos
Explore in Source
Adaptive Immune System
Cell surface interactions at the vascular wall
Hemostasis
Immune System
Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Gene Ontology Terms (18)
Items per page:
10
1 – 7 of 7
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Physical Interaction (IPI)
BHF-UCL
Inferred from Mutant Phenotype (IMP)
UniProtKB
Traceable Author Statement (TAS)
ProtInc
Traceable Author Statement (TAS)
BHF-UCL
Traceable Author Statement (TAS)
BHF-UCL
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (383)
1 – 10 of 383
SELPLG
Tbio
Novelty: 0.00195542
Score: 0.996
Data Source: Reactome,STRINGDB
MADCAM1
Tbio
Novelty: 0.00409055
Score: 0.962
Data Source: Reactome,STRINGDB
CD34
Tbio
Novelty: 0.00007032
Score: 0.954
Data Source: Reactome,STRINGDB
CD44
Tbio
Novelty: 0.00013754
Score: 0.942
Data Source: STRINGDB
PTPRC
Tchem
Family: Enzyme
Novelty: 0.00019614
Score: 0.912
Data Source: STRINGDB
CCR7
Tbio
Family: GPCR
Novelty: 0.00118042
Score: 0.905
Data Source: STRINGDB
CD69
Tchem
Novelty: 0.00072271
Score: 0.905
Data Source: STRINGDB
ITGAM
Tbio
Novelty: 0.0002405
Score: 0.89
Data Source: STRINGDB
FOXP3
Tbio
Family: TF
Novelty: 0.00020363
Score: 0.856
Data Source: STRINGDB
IL7R
Tbio
Novelty: 0.00182378
Score: 0.854
Data Source: STRINGDB
Publication Statistics
PubMed Score  3079.95

PubMed score by year
PubTator Score  1503.74

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MIFPWKCQSTQRDLWNIFKLWGWTMLCCDFLAHHGTDCWTYHYSEKPMNWQRARRFCRDNYTDLVAIQNK
1-70
AEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAG
70-140
KWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEAPELGTMDC
140-210
THPLGNFSFSSQCAFSCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFS
210-280
FTSACTFICSEGTELIGKKKTICESSGIWSNPSPICQKLDKSFSMIKEGDYNPLFIPVAVMVTAFSGLAF
280-350
IIWLARRLKKGKKSKRSMNDPY
350-372
MIFPWKCQSTQRDLWNIFKLWGWTMLCCDFLAHHGTDCWTYHYSEKPMNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQCAFSCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIGKKKTICESSGIWSNPSPICQKLDKSFSMIKEGDYNPLFIPVAVMVTAFSGLAFIIWLARRLKKGKKSKRSMNDPY