You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
HBEGF
Proheparin-binding EGF-like growth factor

Protein Summary
Description
Growth factor that mediates its effects via EGFR, ERBB2 and ERBB4. Required for normal cardiac valve formation and normal heart function. Promotes smooth muscle cell proliferation. May be involved in macrophage-mediated cellular proliferation. It is mitogenic for fibroblasts, but not endothelial cells. It is able to bind EGF receptor/EGFR with higher affinity than EGF itself and is a far more potent mitogen for smooth muscle cells than EGF. Also acts as a diphtheria toxin receptor.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000230990
  • ENSP00000230990
  • ENSG00000113070

Symbol
  • DTR
  • DTS
  • HEGFL
  • DTR
  • DTS
  • DTSF
  • HEGFL
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
virus perturbation
1
PubMedID
0.94
kinase perturbation
0.93
gene perturbation
0.92
small molecule perturbation
0.92


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1541.49   (req: < 5)
Gene RIFs: 144   (req: <= 3)
Antibodies: 368   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1541.49   (req: >= 5)
Gene RIFs: 144   (req: > 3)
Antibodies: 368   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 24
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (85)
Cargo recognition for clathrin-mediated endocytosis (R-HSA-8856825)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 57
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cargo recognition for clathrin-mediated endocytosis
Reactome
Clathrin-mediated endocytosis
Reactome
Constitutive Signaling by Aberrant PI3K in Cancer
Reactome
Cytokine Signaling in Immune system
Reactome
Disease
Name
Explore in Pharos
Explore in Source
Cargo recognition for clathrin-mediated endocytosis
Clathrin-mediated endocytosis
Constitutive Signaling by Aberrant PI3K in Cancer
Cytokine Signaling in Immune system
Disease
Gene Ontology Terms (31)
Items per page:
10
1 – 6 of 6
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Mutant Phenotype (IMP)
UniProtKB
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Traceable Author Statement (TAS)
Reactome
Traceable Author Statement (TAS)
Reactome
Traceable Author Statement (TAS)
Reactome
Protein-Protein Interactions (168)
1 – 10 of 168
EGFR
Tclin
Family: Kinase
Novelty: 0.0000974
Score: 0.993
Data Source: Reactome,STRINGDB
EGF
Tbio
Novelty: 0.00015623
Score: 0.989
Data Source: Reactome,STRINGDB
ERBB4
Tclin
Family: Kinase
Novelty: 0.00154667
Score: 0.989
Data Source: Reactome,STRINGDB
BTC
Tbio
Novelty: 0.00119892
Score: 0.983
Data Source: Reactome,STRINGDB
EREG
Tbio
Novelty: 0.00490116
Score: 0.982
Data Source: Reactome,STRINGDB
ERBB2
Tclin
Family: Kinase
Novelty: 0.00004664
Score: 0.977
Data Source: Reactome,STRINGDB
MMP9
Tchem
Family: Enzyme
Novelty: 0.00010127
Score: 0.968
Data Source: STRINGDB
ADAM17
Tchem
Family: Enzyme
Novelty: 0.00144829
Score: 0.966
Data Source: Reactome,STRINGDB
NRG1
Tbio
Novelty: 0.00114197
Score: 0.96
Data Source: Reactome,STRINGDB
NRG2
Tbio
Novelty: 0.02957789
Score: 0.957
Data Source: Reactome,STRINGDB
Publication Statistics
PubMed Score  1541.49

PubMed score by year
PubTator Score  440.6

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MKLLPSVVLKLFLAAVLSALVTGESLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDRKVRDLQEADLD
1-70
LLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHG
70-140
ERCHGLSLPVENRLYTYDHTTILAVVAVVLSSVCLLVIVGLLMFRYHRRGGYDVENEEKVKLGMTNSH
140-208
MKLLPSVVLKLFLAAVLSALVTGESLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDRKVRDLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSLPVENRLYTYDHTTILAVVAVVLSSVCLLVIVGLLMFRYHRRGGYDVENEEKVKLGMTNSH