You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
TULP1
Tubby-related protein 1

Protein Summary
Description
Required for normal development of photoreceptor synapses. Required for normal photoreceptor function and for long-term survival of photoreceptor cells. Interacts with cytoskeleton proteins and may play a role in protein transport in photoreceptor cells (By similarity). Binds lipids, especially phosphatidylinositol 3-phosphate, phosphatidylinositol 4-phosphate, phosphatidylinositol 5-phosphate, phosphatidylinositol 3,4-bisphosphate, phosphatidylinositol 4,5-bisphosphate, phosphatidylinositol 3,4,5-bisphosphate, phosphatidylserine and phosphatidic acid (in vitro). Contribute to stimulation of phagocytosis of apoptotic retinal pigment epithelium (RPE) cells and macrophages. This gene encodes a member of the tubby-like gene family (TULPs). Members of this family have been identified in plants, vertebrates, and invertebrates. TULP proteins share a conserved C-terminal region of approximately 200 amino acid residues. The protein encoded by this gene is thought to play a role in the physiolo ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000229771
  • ENSP00000229771
  • ENSG00000112041
  • ENST00000322263
  • ENSP00000319414

Symbol
  • TUBL1
  • RP14
  • LCA15
  • TUBL1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
cell type or tissue
0.84
molecular function
0.81
cellular component
0.67
gene perturbation
0.67
tissue sample
0.65


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 50.58   (req: < 5)
Gene RIFs: 18   (req: <= 3)
Antibodies: 91   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 50.58   (req: >= 5)
Gene RIFs: 18   (req: > 3)
Antibodies: 91   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 15
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Protein-Protein Interactions (87)
1 – 10 of 87
RDH12
Tbio
Family: Enzyme
Novelty: 0.02331361
Score: 0.832
Data Source: STRINGDB
CRB1
Tbio
Novelty: 0.00748903
Score: 0.821
Data Source: STRINGDB
AIPL1
Tbio
Novelty: 0.01698342
Score: 0.813
Data Source: STRINGDB
SPATA7
Tbio
Novelty: 0.0863768
Score: 0.811
Data Source: STRINGDB
LCA5
Tbio
Novelty: 0.05221608
Score: 0.792
Data Source: STRINGDB
RPE65
Tbio
Family: Enzyme
Novelty: 0.00219248
Score: 0.75
Data Source: STRINGDB
GUCY2D
Tbio
Family: Kinase
Novelty: 0.00605584
Score: 0.74
Data Source: STRINGDB
LRAT
Tbio
Family: Enzyme
Novelty: 0.02898976
Score: 0.732
Data Source: STRINGDB
RD3
Tbio
Novelty: 0.01019584
Score: 0.718
Data Source: STRINGDB
CEP290
Tbio
Novelty: 0.0076763
Score: 0.718
Data Source: STRINGDB
Publication Statistics
PubMed Score  50.58

PubMed score by year
PubTator Score  37.31

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MPLRDETLREVWASDSGHEEESLSPEAPRRPKQRPAPAQRLRKKRTEAPESPCPTGSKPRKPGAGRTGRP
1-70
REEPSPDPAQARAPQTVYARFLRDPEAKKRDPRETFLVARAPDAEDEEEEEEEDEEDEEEEAEEKKEKIL
70-140
LPPKKPLREKSSADLKERRAKAQGPRGDLGSPDPPPKPLRVRNKEAPAGEGTKMRKTKKKGSGEADKDPS
140-210
GSPASARKSPAAMFLVGEGSPDKKALKKKGTPKGARKEEEEEEEAATVIKKSNQKGKAKGKGKKKAKEER
210-280
APSPPVEVDEPREFVLRPAPQGRTVRCRLTRDKKGMDRGMYPSYFLHLDTEKKVFLLAGRKRKRSKTANY
280-350
LISIDPTNLSRGGENFIGKLRSNLLGNRFTVFDNGQNPQRGYSTNVASLRQELAAVIYETNVLGFRGPRR
350-420
MTVIIPGMSAENERVPIRPRNASDGLLVRWQNKTLESLIELHNKPPVWNDDSGSYTLNFQGRVTQASVKN
420-490
FQIVHADDPDYIVLQFGRVAEDAFTLDYRYPLCALQAFAIALSSFDGKLACE
490-542
MPLRDETLREVWASDSGHEEESLSPEAPRRPKQRPAPAQRLRKKRTEAPESPCPTGSKPRKPGAGRTGRPREEPSPDPAQARAPQTVYARFLRDPEAKKRDPRETFLVARAPDAEDEEEEEEEDEEDEEEEAEEKKEKILLPPKKPLREKSSADLKERRAKAQGPRGDLGSPDPPPKPLRVRNKEAPAGEGTKMRKTKKKGSGEADKDPSGSPASARKSPAAMFLVGEGSPDKKALKKKGTPKGARKEEEEEEEAATVIKKSNQKGKAKGKGKKKAKEERAPSPPVEVDEPREFVLRPAPQGRTVRCRLTRDKKGMDRGMYPSYFLHLDTEKKVFLLAGRKRKRSKTANYLISIDPTNLSRGGENFIGKLRSNLLGNRFTVFDNGQNPQRGYSTNVASLRQELAAVIYETNVLGFRGPRRMTVIIPGMSAENERVPIRPRNASDGLLVRWQNKTLESLIELHNKPPVWNDDSGSYTLNFQGRVTQASVKNFQIVHADDPDYIVLQFGRVAEDAFTLDYRYPLCALQAFAIALSSFDGKLACE