You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
PARP11
Poly [ADP-ribose] polymerase 11

Protein Summary
Description
Plays a role in nuclear envelope stability and nuclear remodeling during spermiogenesis (By similarity). In vitro, exhibits mono(ADP-ribosyl) transferase activity (PubMed:25673562).
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000228820
  • ENSP00000228820
  • ENSG00000111224
  • ENST00000416739
  • ENSP00000392392
  • ENST00000427057
  • ENSP00000397058
  • ENST00000447133
  • ENSP00000405385

Symbol
  • C12orf6
  • ARTD11
  • MIB006
  • C12orf6
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
virus perturbation
0.99
transcription factor perturbation
0.84
microRNA
0.69
transcription factor binding site profile
0.6
cell line
0.59


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2.69   (req: < 5)
Gene RIFs: 1   (req: <= 3)
Antibodies: 122   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2.69   (req: >= 5)
Gene RIFs: 1   (req: > 3)
Antibodies: 122   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 6
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Gene Ontology Terms (8)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
MGI
Protein-Protein Interactions (51)
1 – 10 of 51
RNF166
Tdark
Novelty: 0.66985646
p_int: 0.999890182
p_ni: 0.000107041
p_wrong: 0.000002777
Score: 0.787
Data Source: BioPlex,STRINGDB
MAPK12
Tchem
Family: Kinase
Novelty: 0.01020422
p_int: 0.996635725
p_ni: 0.003364097
p_wrong: 1.78e-7
Score: 0.622
Data Source: BioPlex,STRINGDB
RNF114
Tbio
Family: Enzyme
Novelty: 0.07098319
p_int: 0.985191913
p_ni: 0.014808087
Score: 0.831
Data Source: BioPlex,STRINGDB
CRLF3
Tbio
Novelty: 0.32303174
Score: 0.707
Data Source: STRINGDB
KIAA2013
Tdark
Novelty: 4
Score: 0.697
Data Source: STRINGDB
PPP1R26
Tdark
Family: Enzyme
Novelty: 0.17910448
Score: 0.693
Data Source: STRINGDB
PARP16
Tbio
Family: Enzyme
Novelty: 0.02664352
Score: 0.692
Data Source: STRINGDB
OTUD4
Tbio
Novelty: 0.18201517
Score: 0.675
Data Source: STRINGDB
GM2A
Tbio
Novelty: 0.0083165
Score: 0.674
Data Source: STRINGDB
RCC2
Tbio
Novelty: 0.02815359
Score: 0.653
Data Source: STRINGDB
Publication Statistics
PubMed Score  2.69

PubMed score by year
PubTator Score  4.18

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MWEANPEMFHKAEELFSKTTNNEVDDMDTSDTQWGWFYLAECGKWHMFQPDTNSQCSVSSEDIEKSFKTN
1-70
PCGSISFTTSKFSYKIDFAEMKQMNLTTGKQRLIKRAPFSISAFSYICENEAIPMPPHWENVNTQVPYQL
70-140
IPLHNQTHEYNEVANLFGKTMDRNRIKRIQRIQNLDLWEFFCRKKAQLKKKRGVPQINEQMLFHGTSSEF
140-210
VEAICIHNFDWRINGIHGAVFGKGTYFARDAAYSSRFCKDDIKHGNTFQIHGVSLQQRHLFRTYKSMFLA
210-280
RVLIGDYINGDSKYMRPPSKDGSYVNLYDSCVDDTWNPKIFVVFDANQIYPEYLIDFH
280-338
MWEANPEMFHKAEELFSKTTNNEVDDMDTSDTQWGWFYLAECGKWHMFQPDTNSQCSVSSEDIEKSFKTNPCGSISFTTSKFSYKIDFAEMKQMNLTTGKQRLIKRAPFSISAFSYICENEAIPMPPHWENVNTQVPYQLIPLHNQTHEYNEVANLFGKTMDRNRIKRIQRIQNLDLWEFFCRKKAQLKKKRGVPQINEQMLFHGTSSEFVEAICIHNFDWRINGIHGAVFGKGTYFARDAAYSSRFCKDDIKHGNTFQIHGVSLQQRHLFRTYKSMFLARVLIGDYINGDSKYMRPPSKDGSYVNLYDSCVDDTWNPKIFVVFDANQIYPEYLIDFH