Protein Summary
Ligand for the receptor-type protein-tyrosine kinase KIT. Plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis. KITLG/SCF binding can activate several signaling pathways. Promotes phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase, and subsequent activation of the kinase AKT1. KITLG/SCF and KIT also transmit signals via GRB2 and activation of RAS, RAF1 and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. KITLG/SCF and KIT promote activation of STAT family members STAT1, STAT3 and STAT5. KITLG/SCF and KIT promote activation of PLCG1, leading to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate. KITLG/SCF acts synergistically with other cytokines, probably interleukins. This gene encodes the ligand of the tyrosine-kinase receptor encoded by the KIT locus. This ligand ...more
- ENST00000228280
- ENSP00000228280
- ENSG00000049130
- ENST00000347404
- ENSP00000054216
- ENST00000644744
- ENSP00000495951
- MGF
- SCF
- SF
- MGF
- SCF
- SLF
- DCUA
- FPH2
- FPHH
- KL-1
- Kitl
- SHEP7
- DFNA69
Most Knowledge About | Knowledge Value
(0 to 1 scale) | ||
---|---|---|---|
transcription factor perturbation | 1 | ||
biological process | 0.97 | ||
biological term | 0.97 | ||
gene perturbation | 0.91 | ||
PubMedID | 0.82 | ||
IDG Development Level Summary
These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 1922.18 (req: < 5)
Gene RIFs: 171 (req: <= 3)
Antibodies: 828 (req: <= 50)
These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 1922.18 (req: >= 5)
Gene RIFs: 171 (req: > 3)
Antibodies: 828 (req: > 50)
- OR - satisfy the following criterion:
Gene Ontology Terms: 26
Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions
Active Ligand: 0
Target has at least one approved drug - AND - satisfies the preceding conditions
Active Drug: 0
Protein Data Bank (3)
1 – 3 of 3
PDB Structure Id | Ligand | Method | Resolution (Ã…) | M.W. (kDa) | Pub Year | Title |
---|
PDB Structure Id | M.W. | Resolution | Pub Year |
---|
Pathways (91)
Reactome (20)
KEGG (8)
PathwayCommons (11)
WikiPathways (52)
Click on a row in the table to change the structure displayed.
Items per page:
1 – 5 of 20
Data Source | Name | Explore in Pharos | Explore in Source | ||
---|---|---|---|---|---|
Reactome | Constitutive Signaling by Aberrant PI3K in Cancer | ||||
Reactome | Cytokine Signaling in Immune system | ||||
Reactome | Disease | ||||
Reactome | Diseases of signal transduction | ||||
Reactome | FLT3 Signaling | ||||
Name | Explore in Pharos | Explore in Source | ||
---|---|---|---|---|
Constitutive Signaling by Aberrant PI3K in Cancer | ||||
Cytokine Signaling in Immune system | ||||
Disease | ||||
Diseases of signal transduction | ||||
FLT3 Signaling | ||||
Gene Ontology Terms (34)
Functions (5)
Components (8)
Processes (21)
Items per page:
10
1 – 5 of 5
GO Term | Evidence | Assigned by | ||
---|---|---|---|---|
Traceable Author Statement (TAS) | Reactome | |||
Traceable Author Statement (TAS) | Reactome | |||
Traceable Author Statement (TAS) | ProtInc | |||
Inferred from Electronic Annotation (IEA) | Ensembl | |||
Inferred from Electronic Annotation (IEA) | UniProtKB-KW | |||
Protein-Protein Interactions (302)
1 – 10 of 302
KLHDC10
Novelty: 0.60606061
p_int: 0.999962722
p_ni: 0.00003727
p_wrong: 8e-9
Score: 0.455
Data Source: BioPlex,STRINGDB
ATP8B2
Family: Transporter
Novelty: 0.20856013
p_int: 0.985642839
p_ni: 0.014357161
Score: 0.534
Data Source: BioPlex,STRINGDB
SLC22A18
Family: Transporter
Novelty: 0.00369458
p_int: 0.864467356
p_ni: 0.135388639
p_wrong: 0.000144005
Score: 0.2
Data Source: BioPlex,STRINGDB
KIT
Family: Kinase
Novelty: 0.00013951
Score: 0.999
Data Source: Reactome,STRINGDB
EPO
Novelty: 0.00017234
Score: 0.984
Data Source: STRINGDB
EPOR
Novelty: 0.00150259
Score: 0.97
Data Source: STRINGDB
PDGFRB
Family: Kinase
Novelty: 0.00115144
Score: 0.967
Data Source: STRINGDB
STAT3
Family: TF
Novelty: 0.00013496
Score: 0.966
Data Source: Reactome,STRINGDB
MATK
Family: Kinase
Novelty: 0.00103714
Score: 0.957
Data Source: STRINGDB
FLT3
Family: Kinase
Novelty: 0.00045788
Score: 0.948
Data Source: STRINGDB
Publication Statistics
PubMed Score 1922.18
PubMed score by year
PubTator Score 2278.54
PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MKKTQTWILTCIYLQLLLFNPLVKTEGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWI
1-70
SEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEF
70-140
FRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKAKNPPGD
140-210
SSLHWAAMALPALFSLIIGFAFGALYWKKRQPSLTRAVENIQINEEDNEISMLQEKEREFQEV
210-273
MKKTQTWILTCIYLQLLLFNPLVKTEGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKAKNPPGDSSLHWAAMALPALFSLIIGFAFGALYWKKRQPSLTRAVENIQINEEDNEISMLQEKEREFQEV
Find similar targets by: