You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
WFS1
Wolframin

Protein Summary
Description
Participates in the regulation of cellular Ca(2+) homeostasis, at least partly, by modulating the filling state of the endoplasmic reticulum Ca(2+) store. This gene encodes a transmembrane protein, which is located primarily in the endoplasmic reticulum and ubiquitously expressed with highest levels in brain, pancreas, heart, and insulinoma beta-cell lines. Mutations in this gene are associated with Wolfram syndrome, also called DIDMOAD (Diabetes Insipidus, Diabetes Mellitus, Optic Atrophy, and Deafness), an autosomal recessive disorder. The disease affects the brain and central nervous system. Mutations in this gene can also cause autosomal dominant deafness 6 (DFNA6), also known as DFNA14 or DFNA38. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Mar 2009]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000226760
  • ENSP00000226760
  • ENSG00000109501
  • ENST00000503569
  • ENSP00000423337

Symbol
  • WFS
  • WFRS
  • WFSL
  • CTRCT41
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0.99
disease perturbation
0.83
biological term
0.77
phenotype
0.77
transcription factor perturbation
0.68


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 467.52   (req: < 5)
Gene RIFs: 121   (req: <= 3)
Antibodies: 145   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 467.52   (req: >= 5)
Gene RIFs: 121   (req: > 3)
Antibodies: 145   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 34
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (8)
IRE1alpha activates chaperones (R-HSA-381070)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 7
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
IRE1alpha activates chaperones
Reactome
Metabolism of proteins
Reactome
Post-translational protein modification
Reactome
Post-translational protein phosphorylation
Reactome
Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
Name
Explore in Pharos
Explore in Source
IRE1alpha activates chaperones
Metabolism of proteins
Post-translational protein modification
Post-translational protein phosphorylation
Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
Gene Ontology Terms (41)
Items per page:
10
1 – 5 of 5
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
ParkinsonsUK-UCL
Inferred from Physical Interaction (IPI)
BHF-UCL
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (225)
1 – 10 of 225
ADIPOR1
Tbio
Novelty: 0.00339654
p_int: 0.9092768
p_ni: 0.0907232
Score: 0.299
Data Source: BioPlex,STRINGDB
P2RX2
Tchem
Family: IC
Novelty: 0.00308345
p_int: 0.854403704
p_ni: 0.145596296
Score: 0.189
Data Source: BioPlex,STRINGDB
YIPF3
Tbio
Novelty: 0.03141831
p_int: 0.847528002
p_ni: 0.152471998
Score: 0.151
Data Source: BioPlex,STRINGDB
ANTXR1
Tbio
Novelty: 0.00562876
p_int: 0.759535796
p_ni: 0.240464204
Score: 0.201
Data Source: BioPlex,STRINGDB
HSP90B1
Tchem
Novelty: 0.00167817
Score: 0.964
Data Source: STRINGDB
DNAJC3
Tbio
Novelty: 0.03555633
Score: 0.94
Data Source: STRINGDB
ATF6
Tbio
Family: TF
Novelty: 0.00214036
Score: 0.935
Data Source: STRINGDB
P4HB
Tbio
Family: Enzyme
Novelty: 0.00117072
Score: 0.921
Data Source: STRINGDB
GPC3
Tbio
Novelty: 0.00107694
Score: 0.919
Data Source: STRINGDB
IL6
Tclin
Novelty: 0.00002829
Score: 0.918
Data Source: STRINGDB
Publication Statistics
PubMed Score  467.52

PubMed score by year
PubTator Score  218.91

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MDSNTAPLGPSCPQPPPAPQPQARSRLNATASLEQERSERPRAPGPQAGPGPGVRDAAAPAEPQAQHTRS
1-70
RERADGTGPTKGDMEIPFEEVLERAKAGDPKAQTEVGKHYLQLAGDTDEELNSCTAVDWLVLAAKQGRRE
70-140
AVKLLRRCLADRRGITSENEREVRQLSSETDLERAVRKAALVMYWKLNPKKKKQVAVAELLENVGQVNEH
140-210
DGGAQPGPVPKSLQKQRRMLERLVSSESKNYIALDDFVEITKKYAKGVIPSSLFLQDDEDDDELAGKSPE
210-280
DLPLRLKVVKYPLHAIMEIKEYLIDMASRAGMHWLSTIIPTHHINALIFFFIVSNLTIDFFAFFIPLVIF
280-350
YLSFISMVICTLKVFQDSKAWENFRTLTDLLLRFEPNLDVEQAEVNFGWNHLEPYAHFLLSVFFVIFSFP
350-420
IASKDCIPCSELAVITGFFTVTSYLSLSTHAEPYTRRALATEVTAGLLSLLPSMPLNWPYLKVLGQTFIT
420-490
VPVGHLVVLNVSVPCLLYVYLLYLFFRMAQLRNFKGTYCYLVPYLVCFMWCELSVVILLESTGLGLLRAS
490-560
IGYFLFLFALPILVAGLALVGVLQFARWFTSLELTKIAVTVAVCSVPLLLRWWTKASFSVVGMVKSLTRS
560-630
SMVKLILVWLTAIVLFCWFYVYRSEGMKVYNSTLTWQQYGALCGPRAWKETNMARTQILCSHLEGHRVTW
630-700
TGRFKYVRVTDIDNSAESAINMLPFFIGDWMRCLYGEAYPACSPGNTSTAEEELCRLKLLAKHPCHIKKF
700-770
DRYKFEITVGMPFSSGADGSRSREEDDVTKDIVLRASSEFKSVLLSLRQGSLIEFSTILEGRLGSKWPVF
770-840
ELKAISCLNCMAQLSPTRRHVKIEHDWRSTVHGAVKFAFDFFFFPFLSAA
840-890
MDSNTAPLGPSCPQPPPAPQPQARSRLNATASLEQERSERPRAPGPQAGPGPGVRDAAAPAEPQAQHTRSRERADGTGPTKGDMEIPFEEVLERAKAGDPKAQTEVGKHYLQLAGDTDEELNSCTAVDWLVLAAKQGRREAVKLLRRCLADRRGITSENEREVRQLSSETDLERAVRKAALVMYWKLNPKKKKQVAVAELLENVGQVNEHDGGAQPGPVPKSLQKQRRMLERLVSSESKNYIALDDFVEITKKYAKGVIPSSLFLQDDEDDDELAGKSPEDLPLRLKVVKYPLHAIMEIKEYLIDMASRAGMHWLSTIIPTHHINALIFFFIVSNLTIDFFAFFIPLVIFYLSFISMVICTLKVFQDSKAWENFRTLTDLLLRFEPNLDVEQAEVNFGWNHLEPYAHFLLSVFFVIFSFPIASKDCIPCSELAVITGFFTVTSYLSLSTHAEPYTRRALATEVTAGLLSLLPSMPLNWPYLKVLGQTFITVPVGHLVVLNVSVPCLLYVYLLYLFFRMAQLRNFKGTYCYLVPYLVCFMWCELSVVILLESTGLGLLRASIGYFLFLFALPILVAGLALVGVLQFARWFTSLELTKIAVTVAVCSVPLLLRWWTKASFSVVGMVKSLTRSSMVKLILVWLTAIVLFCWFYVYRSEGMKVYNSTLTWQQYGALCGPRAWKETNMARTQILCSHLEGHRVTWTGRFKYVRVTDIDNSAESAINMLPFFIGDWMRCLYGEAYPACSPGNTSTAEEELCRLKLLAKHPCHIKKFDRYKFEITVGMPFSSGADGSRSREEDDVTKDIVLRASSEFKSVLLSLRQGSLIEFSTILEGRLGSKWPVFELKAISCLNCMAQLSPTRRHVKIEHDWRSTVHGAVKFAFDFFFFPFLSAA