You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
CYP26A1
Cytochrome P450 26A1

Protein Summary
Description
Plays a key role in retinoic acid metabolism. Acts on retinoids, including all-trans-retinoic acid (RA) and its stereoisomer 9-cis-RA. Capable of both 4-hydroxylation and 18-hydroxylation. Responsible for generation of several hydroxylated forms of RA, including 4-OH-RA, 4-oxo-RA and 18-OH-RA. Has also a significant activity in oxidation of tazarotenic acid and may therefore metabolize that xenobiotic in vivo. This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This endoplasmic reticulum protein acts on retinoids, including all-trans-retinoic acid (RA), with both 4-hydroxylation and 18-hydroxylation activities. This enzyme regulates the cellular level of retinoic acid which is involved in regulation of gene expression in both embryonic and adult tissues. Two alternatively spliced transcript variants of t ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000224356
  • ENSP00000224356
  • ENSG00000095596
  • ENST00000371531
  • ENSP00000360586

Symbol
  • CYP26
  • P450RAI1
  • CP26
  • CYP26
  • P450RAI
  • P450RAI1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
gene perturbation
0.91
pathway
0.91
PubMedID
0.9
molecular function
0.86
cell type or tissue
0.82


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 296.24   (req: < 5)
Gene RIFs: 30   (req: <= 3)
Antibodies: 268   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 296.24   (req: >= 5)
Gene RIFs: 30   (req: > 3)
Antibodies: 268   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 16
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 93
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (34)
Biological oxidations (R-HSA-211859)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 9
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Biological oxidations
Reactome
Cytochrome P450 - arranged by substrate type
Reactome
Metabolism
Reactome
Phase I - Functionalization of compounds
Reactome
RA biosynthesis pathway
Name
Explore in Pharos
Explore in Source
Biological oxidations
Cytochrome P450 - arranged by substrate type
Metabolism
Phase I - Functionalization of compounds
RA biosynthesis pathway
Gene Ontology Terms (18)
Items per page:
10
1 – 6 of 6
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
BHF-UCL
Traceable Author Statement (TAS)
ProtInc
Non-traceable Author Statement (NAS)
BHF-UCL
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (118)
1 – 10 of 118
ALDH1A2
Tbio
Family: Enzyme
Novelty: 0.00544461
Score: 0.991
Data Source: STRINGDB
RDH10
Tbio
Family: Enzyme
Novelty: 0.03283214
Score: 0.974
Data Source: STRINGDB
LRAT
Tbio
Family: Enzyme
Novelty: 0.02898976
Score: 0.97
Data Source: STRINGDB
ALDH1A1
Tchem
Family: Enzyme
Novelty: 0.00144812
Score: 0.967
Data Source: STRINGDB
CRABP1
Tbio
Novelty: 0.00320013
Score: 0.967
Data Source: Reactome,STRINGDB
DHRS3
Tbio
Family: Enzyme
Novelty: 0.05219166
Score: 0.962
Data Source: STRINGDB
RDH16
Tbio
Family: Enzyme
Novelty: 0.14154245
Score: 0.953
Data Source: STRINGDB
DHRS9
Tbio
Family: Enzyme
Novelty: 0.00329747
Score: 0.948
Data Source: STRINGDB
ADH7
Tchem
Family: Enzyme
Novelty: 0.0066812
Score: 0.942
Data Source: STRINGDB
RETSAT
Tdark
Family: Enzyme
Novelty: 0.14624727
Score: 0.935
Data Source: STRINGDB
Publication Statistics
PubMed Score  296.24

PubMed score by year
PubTator Score  167.42

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MGLPALLASALCTFVLPLLLFLAAIKLWDLYCVSGRDRSCALPLPPGTMGFPFFGETLQMVLQRRKFLQM
1-70
KRRKYGFIYKTHLFGRPTVRVMGADNVRRILLGEHRLVSVHWPASVRTILGSGCLSNLHDSSHKQRKKVI
70-140
MRAFSREALECYVPVITEEVGSSLEQWLSCGERGLLVYPEVKRLMFRIAMRILLGCEPQLAGDGDSEQQL
140-210
VEAFEEMTRNLFSLPIDVPFSGLYRGMKARNLIHARIEQNIRAKICGLRASEAGQGCKDALQLLIEHSWE
210-280
RGERLDMQALKQSSTELLFGGHETTASAATSLITYLGLYPHVLQKVREELKSKGLLCKSNQDNKLDMEIL
280-350
EQLKYIGCVIKETLRLNPPVPGGFRVALKTFELNGYQIPKGWNVIYSICDTHDVAEIFTNKEEFNPDRFM
350-420
LPHPEDASRFSFIPFGGGLRSCVGKEFAKILLKIFTVELARHCDWQLLNGPPTMKTSPTVYPVDNLPARF
420-490
THFHGEI
490-497
MGLPALLASALCTFVLPLLLFLAAIKLWDLYCVSGRDRSCALPLPPGTMGFPFFGETLQMVLQRRKFLQMKRRKYGFIYKTHLFGRPTVRVMGADNVRRILLGEHRLVSVHWPASVRTILGSGCLSNLHDSSHKQRKKVIMRAFSREALECYVPVITEEVGSSLEQWLSCGERGLLVYPEVKRLMFRIAMRILLGCEPQLAGDGDSEQQLVEAFEEMTRNLFSLPIDVPFSGLYRGMKARNLIHARIEQNIRAKICGLRASEAGQGCKDALQLLIEHSWERGERLDMQALKQSSTELLFGGHETTASAATSLITYLGLYPHVLQKVREELKSKGLLCKSNQDNKLDMEILEQLKYIGCVIKETLRLNPPVPGGFRVALKTFELNGYQIPKGWNVIYSICDTHDVAEIFTNKEEFNPDRFMLPHPEDASRFSFIPFGGGLRSCVGKEFAKILLKIFTVELARHCDWQLLNGPPTMKTSPTVYPVDNLPARFTHFHGEI