You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
CEACAM5
Carcinoembryonic antigen-related cell adhesion molecule 5

Protein Summary
Description
Cell surface glycoprotein that plays a role in cell adhesion, intracellular signaling and tumor progression (PubMed:2803308, PubMed:10910050, PubMed:10864933). Mediates homophilic and heterophilic cell adhesion with other carcinoembryonic antigen-related cell adhesion molecules, such as CEACAM6 (PubMed:2803308). Plays a role as an oncogene by promoting tumor progression; induces resistance to anoikis of colorectal carcinoma cells (PubMed:10910050). (Microbial infection) Receptor for E.coli Dr adhesins. Binding of E.coli Dr adhesins leads to dissociation of the homodimer. This gene encodes a cell surface glycoprotein that represents the founding member of the carcinoembryonic antigen (CEA) family of proteins. The encoded protein is used as a clinical biomarker for gastrointestinal cancers and may promote tumor development through its role as a cell adhesion molecule. Additionally, the encoded protein may regulate differentiation, apoptosis, and cell polarity. This gene is present in a C ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000221992
  • ENSP00000221992
  • ENSG00000105388
  • ENST00000398599
  • ENSP00000381600
  • ENST00000405816
  • ENSP00000385072

Symbol
  • CEA
  • CEA
  • CD66e
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological term
0.86
cell type or tissue
0.85
protein domain
0.85
small molecule perturbation
0.75
cellular component
0.74


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 9668.86   (req: < 5)
Gene RIFs: 185   (req: <= 3)
Antibodies: 2952   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 9668.86   (req: >= 5)
Gene RIFs: 185   (req: > 3)
Antibodies: 2952   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 11
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (4)
1 – 4 of 4
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (5)
Cell surface interactions at the vascular wall (R-HSA-202733)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 5
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cell surface interactions at the vascular wall
Reactome
Hemostasis
Reactome
Metabolism of proteins
Reactome
Post-translational modification: synthesis of GPI-anchored proteins
Reactome
Post-translational protein modification
Name
Explore in Pharos
Explore in Source
Cell surface interactions at the vascular wall
Hemostasis
Metabolism of proteins
Post-translational modification: synthesis of GPI-anchored proteins
Post-translational protein modification
Protein-Protein Interactions (178)
1 – 10 of 178
MSLN
Tbio
Novelty: 0.00216852
Score: 0.962
Data Source: STRINGDB
PSCA
Tbio
Novelty: 0.00370639
Score: 0.933
Data Source: STRINGDB
GPLD1
Tbio
Family: Enzyme
Novelty: 0.00834598
Score: 0.923
Data Source: STRINGDB
CEACAM7
Tbio
Novelty: 0.07752214
Score: 0.92
Data Source: STRINGDB
AFP
Tbio
Novelty: 0.00006259
Score: 0.92
Data Source: STRINGDB
LY6K
Tbio
Novelty: 0.02096908
Score: 0.917
Data Source: STRINGDB
THY1
Tbio
Novelty: 0.00046162
Score: 0.917
Data Source: STRINGDB
ALPI
Tbio
Family: Enzyme
Novelty: 0.00247141
Score: 0.916
Data Source: STRINGDB
ALPG
Tchem
Family: Enzyme
Novelty: 0.00264445
Score: 0.913
Data Source: STRINGDB
CD52
Tclin
Novelty: 0.00178612
Score: 0.912
Data Source: STRINGDB
Publication Statistics
PubMed Score  9668.86

PubMed score by year
PubTator Score  341.44

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MESPSAPPHRWCIPWQRLLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKG
1-70
ERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRV
70-140
YPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDT
140-210
ASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQS
210-280
TQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQ
280-350
NTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNKLSVDHSDPVILNVLYGPDDPTI
350-420
SPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTT
420-490
VKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFN
490-560
VTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRIN
560-630
GIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSAGATVGIMIGVLVGVA
630-700
LI
700-702
MESPSAPPHRWCIPWQRLLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNKLSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSAGATVGIMIGVLVGVALI