You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
PLAT
Tissue-type plasminogen activator

Protein Summary
Description
Converts the abundant, but inactive, zymogen plasminogen to plasmin by hydrolyzing a single Arg-Val bond in plasminogen. By controlling plasmin-mediated proteolysis, it plays an important role in tissue remodeling and degradation, in cell migration and many other physiopathological events. Plays a direct role in facilitating neuronal migration. This gene encodes tissue-type plasminogen activator, a secreted serine protease that converts the proenzyme plasminogen to plasmin, a fibrinolytic enzyme. The encoded preproprotein is proteolytically processed by plasmin or trypsin to generate heavy and light chains. These chains associate via disulfide linkages to form the heterodimeric enzyme. This enzyme plays a role in cell migration and tissue remodeling. Increased enzymatic activity causes hyperfibrinolysis, which manifests as excessive bleeding, while decreased activity leads to hypofibrinolysis, which can result in thrombosis or embolism. Alternative splicing of this gene results in mult ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000220809
  • ENSP00000220809
  • ENSG00000104368
  • ENST00000352041
  • ENSP00000270188
  • ENST00000429089
  • ENSP00000392045

Symbol
  • TPA
  • T-PA
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
gene perturbation
1
protein domain
1
biological term
0.99
disease
0.97
small molecule perturbation
0.91


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 6029.35   (req: < 5)
Gene RIFs: 234   (req: <= 3)
Antibodies: 725   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 6029.35   (req: >= 5)
Gene RIFs: 234   (req: > 3)
Antibodies: 725   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 13
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 75
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 1
Approved Drugs (1)
1 – 1 of 1
aminocaproic acid
chemical structure image
Protein Data Bank (10)
1 – 5 of 10
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (23)
Dissolution of Fibrin Clot (R-HSA-75205)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 5
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Dissolution of Fibrin Clot
Reactome
Hemostasis
Reactome
Signal Transduction
Reactome
Signaling by PDGF
Reactome
Signaling by Receptor Tyrosine Kinases
Name
Explore in Pharos
Explore in Source
Dissolution of Fibrin Clot
Hemostasis
Signal Transduction
Signaling by PDGF
Signaling by Receptor Tyrosine Kinases
Protein-Protein Interactions (132)
1 – 10 of 132
SERPINB2
Tbio
Novelty: 0.00223708
p_int: 0.999991505
p_ni: 0.000008495
Score: 0.963
Data Source: BioPlex,STRINGDB
SERPINF2
Tbio
Novelty: 0.00058646
p_int: 0.999942222
p_ni: 0.000057778
Score: 0.984
Data Source: BioPlex,STRINGDB
CCL3L1
Tbio
Novelty: 0.01605247
p_int: 0.998736274
p_ni: 0.001263726
Score: 0.224
Data Source: BioPlex,STRINGDB
SERPING1
Tbio
Family: Enzyme
Novelty: 0.00076515
p_int: 0.99574881
p_ni: 0.00425119
Score: 0.605
Data Source: BioPlex,STRINGDB
SERPINA10
Tbio
Family: Enzyme
Novelty: 0.01260618
p_int: 0.994794209
p_ni: 0.005205791
Score: 0.373
Data Source: BioPlex,STRINGDB
MSMB
Tbio
Novelty: 0.00164465
p_int: 0.977650264
p_ni: 0.0223497
p_wrong: 3.7e-8
Data Source: BioPlex
PLA2G10
Tchem
Family: Enzyme
Novelty: 0.00367717
p_int: 0.862954114
p_ni: 0.137045835
p_wrong: 5.2e-8
Score: 0.186
Data Source: BioPlex,STRINGDB
LY86
Tbio
Novelty: 0.00136228
p_int: 0.848943307
p_ni: 0.151056439
p_wrong: 2.54e-7
Data Source: BioPlex
SERPINB6
Tbio
Novelty: 0.00166761
p_int: 0.838717049
p_ni: 0.161279445
p_wrong: 0.000003507
Score: 0.436
Data Source: BioPlex,STRINGDB
SERPINE2
Tbio
Novelty: 0.00275751
p_int: 0.835763985
p_ni: 0.164233778
p_wrong: 0.000002238
Score: 0.979
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  6029.35

PubMed score by year
PubTator Score  4327.97

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MDAMKRGLCCVLLLCGAVFVSPSQEIHARFRRGARSYQVICRDEKTQMIYQQHQSWLRPVLRSNRVEYCW
1-70
CNSGRAQCHSVPVKSCSEPRCFNGGTCQQALYFSDFVCQCPEGFAGKCCEIDTRATCYEDQGISYRGTWS
70-140
TAESGAECTNWNSSALAQKPYSGRRPDAIRLGLGNHNYCRNPDRDSKPWCYVFKAGKYSSEFCSTPACSE
140-210
GNSDCYFGNGSAYRGTHSLTESGASCLPWNSMILIGKVYTAQNPSAQALGLGKHNYCRNPDGDAKPWCHV
210-280
LKNRRLTWEYCDVPSCSTCGLRQYSQPQFRIKGGLFADIASHPWQAAIFAKHRRSPGERFLCGGILISSC
280-350
WILSAAHCFQERFPPHHLTVILGRTYRVVPGEEEQKFEVEKYIVHKEFDDDTYDNDIALLQLKSDSSRCA
350-420
QESSVVRTVCLPPADLQLPDWTECELSGYGKHEALSPFYSERLKEAHVRLYPSSRCTSQHLLNRTVTDNM
420-490
LCAGDTRSGGPQANLHDACQGDSGGPLVCLNDGRMTLVGIISWGLGCGQKDVPGVYTKVTNYLDWIRDNM
490-560
RP
560-562
MDAMKRGLCCVLLLCGAVFVSPSQEIHARFRRGARSYQVICRDEKTQMIYQQHQSWLRPVLRSNRVEYCWCNSGRAQCHSVPVKSCSEPRCFNGGTCQQALYFSDFVCQCPEGFAGKCCEIDTRATCYEDQGISYRGTWSTAESGAECTNWNSSALAQKPYSGRRPDAIRLGLGNHNYCRNPDRDSKPWCYVFKAGKYSSEFCSTPACSEGNSDCYFGNGSAYRGTHSLTESGASCLPWNSMILIGKVYTAQNPSAQALGLGKHNYCRNPDGDAKPWCHVLKNRRLTWEYCDVPSCSTCGLRQYSQPQFRIKGGLFADIASHPWQAAIFAKHRRSPGERFLCGGILISSCWILSAAHCFQERFPPHHLTVILGRTYRVVPGEEEQKFEVEKYIVHKEFDDDTYDNDIALLQLKSDSSRCAQESSVVRTVCLPPADLQLPDWTECELSGYGKHEALSPFYSERLKEAHVRLYPSSRCTSQHLLNRTVTDNMLCAGDTRSGGPQANLHDACQGDSGGPLVCLNDGRMTLVGIISWGLGCGQKDVPGVYTKVTNYLDWIRDNMRP