You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
ATP12A
Potassium-transporting ATPase alpha chain 2

Protein Summary
Description
Catalyzes the hydrolysis of ATP coupled with the exchange of H(+) and K(+) ions across the plasma membrane. Responsible for potassium absorption in various tissues. The protein encoded by this gene belongs to the family of P-type cation transport ATPases. This gene encodes a catalytic subunit of the ouabain-sensitive H+/K+ -ATPase that catalyzes the hydrolysis of ATP coupled with the exchange of H(+) and K(+) ions across the plasma membrane. It is also responsible for potassium absorption in various tissues. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2010]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000218548
  • ENSP00000218548
  • ENSG00000075673
  • ENST00000381946
  • ENSP00000371372

Symbol
  • ATP1AL1
  • HK
  • ATP1AL1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
1
protein domain
1
gene perturbation
0.67
PubMedID
0.66
cellular component
0.63


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 6954.99   (req: < 5)
Gene RIFs: 12   (req: <= 3)
Antibodies: 123   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 6954.99   (req: >= 5)
Gene RIFs: 12   (req: > 3)
Antibodies: 123   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 10
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 10
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Active Ligands (10)
1 – 10 of 10
CHEMBL2068911
chemical structure image
CHEMBL2068890
chemical structure image
CHEMBL319670
chemical structure image
CHEMBL104027
chemical structure image
CHEMBL321090
chemical structure image
CHEMBL2068917
chemical structure image
CHEMBL323301
chemical structure image
CHEMBL1453
chemical structure image
CHEMBL318786
chemical structure image
CHEMBL2093999
chemical structure image
Pathways (5)
Ion channel transport (R-HSA-983712)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Ion channel transport
Reactome
Ion transport by P-type ATPases
Reactome
Transport of small molecules
Name
Explore in Pharos
Explore in Source
Ion channel transport
Ion transport by P-type ATPases
Transport of small molecules
Protein-Protein Interactions (216)
1 – 10 of 216
ATP1B3
Tclin
Family: Transporter
Novelty: 0.07056603
p_int: 0.995225141
p_ni: 0.004774859
Score: 0.843
Data Source: BioPlex,STRINGDB
FXYD6
Tbio
Family: IC
Novelty: 0.05831997
p_int: 0.990399955
p_ni: 0.009600045
Data Source: BioPlex
TNFRSF10C
Tbio
Novelty: 0.00061543
p_int: 0.987623754
p_ni: 0.012376246
Data Source: BioPlex
ART3
Tbio
Family: Enzyme
Novelty: 0.02057948
p_int: 0.984380962
p_ni: 0.015619035
p_wrong: 3e-9
Score: 0.152
Data Source: BioPlex,STRINGDB
TRARG1
Tbio
Novelty: 0.00245775
p_int: 0.980613323
p_ni: 0.019386676
Data Source: BioPlex
TIMM23
Tbio
Family: Enzyme
Novelty: 0.09116839
p_int: 0.979089217
p_ni: 0.020910782
p_wrong: 1e-9
Data Source: BioPlex
LAGE3
Tdark
Novelty: 0.03704357
p_int: 0.976223299
p_ni: 0.023776701
Data Source: BioPlex
UPK2
Tbio
Novelty: 0.0107781
p_int: 0.976180959
p_ni: 0.023819041
Data Source: BioPlex
SLC2A5
Tbio
Family: Transporter
Novelty: 0.00434919
p_int: 0.975421714
p_ni: 0.024578286
Score: 0.181
Data Source: BioPlex,STRINGDB
CCR6
Tchem
Family: GPCR
Novelty: 0.00438964
p_int: 0.972204828
p_ni: 0.027795172
Data Source: BioPlex
Publication Statistics
PubMed Score  6954.99

PubMed score by year
PubTator Score  108.5

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MHQKTPEIYSVELSGTKDIVKTDKGDGKEKYRGLKNNCLELKKKNHKEEFQKELHLDDHKLSNRELEEKY
1-70
GTDIIMGLSSTRAAELLARDGPNSLTPPKQTPEIVKFLKQMVGGFSILLWVGAFLCWIAYGIQYSSDKSA
70-140
SLNNVYLGCVLGLVVILTGIFAYYQEAKSTNIMSSFNKMIPQQALVIRDSEKKTIPSEQLVVGDIVEVKG
140-210
GDQIPADIRVLSSQGCRVDNSSLTGESEPQPRSSEFTHENPLETKNICFYSTTCLEGTVTGMVINTGDRT
210-280
IIGHIASLASGVGNEKTPIAIEIEHFVHIVAGVAVSIGILFFIIAVSLKYQVLDSIIFLIGIIVANVPEG
280-350
LLATVTVTLSLTAKRMAKKNCLVKNLEAVETLGSTSIICSDKTGTLTQNRMTVAHLWFDNQIFVADTSED
350-420
HSNQVFDQSSRTWASLSKIITLCNRAEFKPGQENVPIMKKAVIGDASETALLKFSEVILGDVMEIRKRNR
420-490
KVAEIPFNSTNKFQLSIHEMDDPHGKRFLMVMKGAPERILEKCSTIMINGEEHPLDKSTAKTFHTAYMEL
490-560
GGLGERVLGFCHLYLPADEFPETYSFDIDAMNFPTSNLCFVGLLSMIDPPRSTVPDAVTKCRSAGIKVIM
560-630
VTGDHPITAKAIAKSVGIISANSETVEDIAHRLNIAVEQVNKRDAKAAVVTGMELKDMSSEQLDEILANY
630-700
QEIVFARTSPQQKLIIVEGCQRQDAVVAVTGDGVNDSPALKKADIGIAMGIAGSDAAKNAADMVLLDDNF
700-770
ASIVTGVEEGRLIFDNLKKTIAYSLTKNIAELCPFLIYIIVGLPLPIGTITILFIDLGTDIIPSIALAYE
770-840
KAESDIMNRKPRHKNKDRLVNQPLAVYSYLHIGLMQALGAFLVYFTVYAQEGFLPRTLINLRVEWEKDYV
840-910
NDLKDSYGQEWTRYQREYLEWTGYTAFFVGILVQQIADLIIRKTRRNSIFQQGLFRNKVIWVGITSQIII
910-980
GLILSYGLGSVTALSFTMLRAQYWFVAVPHAILIWVYDEVRKLFIRLYPGSWWDKNMYY
980-1039
MHQKTPEIYSVELSGTKDIVKTDKGDGKEKYRGLKNNCLELKKKNHKEEFQKELHLDDHKLSNRELEEKYGTDIIMGLSSTRAAELLARDGPNSLTPPKQTPEIVKFLKQMVGGFSILLWVGAFLCWIAYGIQYSSDKSASLNNVYLGCVLGLVVILTGIFAYYQEAKSTNIMSSFNKMIPQQALVIRDSEKKTIPSEQLVVGDIVEVKGGDQIPADIRVLSSQGCRVDNSSLTGESEPQPRSSEFTHENPLETKNICFYSTTCLEGTVTGMVINTGDRTIIGHIASLASGVGNEKTPIAIEIEHFVHIVAGVAVSIGILFFIIAVSLKYQVLDSIIFLIGIIVANVPEGLLATVTVTLSLTAKRMAKKNCLVKNLEAVETLGSTSIICSDKTGTLTQNRMTVAHLWFDNQIFVADTSEDHSNQVFDQSSRTWASLSKIITLCNRAEFKPGQENVPIMKKAVIGDASETALLKFSEVILGDVMEIRKRNRKVAEIPFNSTNKFQLSIHEMDDPHGKRFLMVMKGAPERILEKCSTIMINGEEHPLDKSTAKTFHTAYMELGGLGERVLGFCHLYLPADEFPETYSFDIDAMNFPTSNLCFVGLLSMIDPPRSTVPDAVTKCRSAGIKVIMVTGDHPITAKAIAKSVGIISANSETVEDIAHRLNIAVEQVNKRDAKAAVVTGMELKDMSSEQLDEILANYQEIVFARTSPQQKLIIVEGCQRQDAVVAVTGDGVNDSPALKKADIGIAMGIAGSDAAKNAADMVLLDDNFASIVTGVEEGRLIFDNLKKTIAYSLTKNIAELCPFLIYIIVGLPLPIGTITILFIDLGTDIIPSIALAYEKAESDIMNRKPRHKNKDRLVNQPLAVYSYLHIGLMQALGAFLVYFTVYAQEGFLPRTLINLRVEWEKDYVNDLKDSYGQEWTRYQREYLEWTGYTAFFVGILVQQIADLIIRKTRRNSIFQQGLFRNKVIWVGITSQIIIGLILSYGLGSVTALSFTMLRAQYWFVAVPHAILIWVYDEVRKLFIRLYPGSWWDKNMYY