You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
TIMP1
Metalloproteinase inhibitor 1

Protein Summary
Description
Metalloproteinase inhibitor that functions by forming one to one complexes with target metalloproteinases, such as collagenases, and irreversibly inactivates them by binding to their catalytic zinc cofactor. Acts on MMP1, MMP2, MMP3, MMP7, MMP8, MMP9, MMP10, MMP11, MMP12, MMP13 and MMP16. Does not act on MMP14. Also functions as a growth factor that regulates cell differentiation, migration and cell death and activates cellular signaling cascades via CD63 and ITGB1. Plays a role in integrin signaling. Mediates erythropoiesis in vitro; but, unlike IL3, it is species-specific, stimulating the growth and differentiation of only human and murine erythroid progenitors. This gene belongs to the TIMP gene family. The proteins encoded by this gene family are natural inhibitors of the matrix metalloproteinases (MMPs), a group of peptidases involved in degradation of the extracellular matrix. In addition to its inhibitory role against most of the known MMPs, the encoded protein is able to promot ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000218388
  • ENSP00000218388
  • ENSG00000102265

Symbol
  • CLGI
  • TIMP
  • EPA
  • EPO
  • HCI
  • CLGI
  • TIMP
  • TIMP-1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological term
1
kinase perturbation
0.99
chemical
0.98
phenotype
0.91
transcription factor perturbation
0.91


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 3865.62   (req: < 5)
Gene RIFs: 564   (req: <= 3)
Antibodies: 1007   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 3865.62   (req: >= 5)
Gene RIFs: 564   (req: > 3)
Antibodies: 1007   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 27
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (7)
1 – 5 of 7
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (74)
Activation of Matrix Metalloproteinases (R-HSA-1592389)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 16
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Activation of Matrix Metalloproteinases
Reactome
Cytokine Signaling in Immune system
Reactome
Degradation of the extracellular matrix
Reactome
Extracellular matrix organization
Reactome
Hemostasis
Name
Explore in Pharos
Explore in Source
Activation of Matrix Metalloproteinases
Cytokine Signaling in Immune system
Degradation of the extracellular matrix
Extracellular matrix organization
Hemostasis
Gene Ontology Terms (34)
Items per page:
10
1 – 6 of 6
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (398)
1 – 10 of 398
MMP9
Tchem
Family: Enzyme
Novelty: 0.00010127
p_int: 0.999998964
p_ni: 0.000001
p_wrong: 3.6e-8
Score: 0.997
Data Source: BioPlex,Reactome,STRINGDB
MMP10
Tchem
Novelty: 0.00168502
p_int: 0.995707391
p_ni: 0.004180686
p_wrong: 0.000111922
Score: 0.957
Data Source: BioPlex,STRINGDB
IGFBP1
Tchem
Novelty: 0.00083344
p_int: 0.985022977
p_ni: 0.014728711
p_wrong: 0.000248313
Score: 0.95
Data Source: BioPlex,STRINGDB
FGFR2
Tclin
Family: Kinase
Novelty: 0.00077461
p_int: 0.970905138
p_ni: 0.024193598
p_wrong: 0.004901264
Score: 0.31
Data Source: BioPlex,STRINGDB
MMP1
Tchem
Family: Enzyme
Novelty: 0.00035126
Score: 0.994
Data Source: STRINGDB
MMP3
Tchem
Novelty: 0.00050371
Score: 0.989
Data Source: STRINGDB
IL6
Tclin
Novelty: 0.00002829
Score: 0.982
Data Source: STRINGDB
TGFB1
Tchem
Novelty: 0.00014007
Score: 0.98
Data Source: STRINGDB
MMP14
Tchem
Family: Enzyme
Novelty: 0.00092685
Score: 0.98
Data Source: STRINGDB
IL10
Tbio
Novelty: 0.00007359
Score: 0.979
Data Source: STRINGDB
Publication Statistics
PubMed Score  3865.62

PubMed score by year
PubTator Score  2856.02

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAPFEPLASGILLLLWLIAPSRACTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYK
1-70
GFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFT
70-140
KTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIA
140-207
MAPFEPLASGILLLLWLIAPSRACTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIA