You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
ST13
Hsc70-interacting protein

Protein Summary
Description
One HIP oligomer binds the ATPase domains of at least two HSC70 molecules dependent on activation of the HSC70 ATPase by HSP40. Stabilizes the ADP state of HSC70 that has a high affinity for substrate protein. Through its own chaperone activity, it may contribute to the interaction of HSC70 with various target proteins (By similarity). The protein encoded by this gene is an adaptor protein that mediates the association of the heat shock proteins HSP70 and HSP90. This protein has been shown to be involved in the assembly process of glucocorticoid receptor, which requires the assistance of multiple molecular chaperones. The expression of this gene is reported to be downregulated in colorectal carcinoma tissue suggesting that it is a candidate tumor suppressor gene. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jun 2013]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000216218
  • ENSP00000216218
  • ENSG00000100380

Symbol
  • AAG2
  • FAM10A1
  • HIP
  • SNC6
  • HIP
  • HOP
  • P48
  • AAG2
  • SNC6
  • HSPABP
  • FAM10A1
  • FAM10A4
  • HSPABP1
  • PRO0786
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
disease perturbation
1
kinase perturbation
1
virus perturbation
0.99
molecular function
0.88
protein domain
0.85


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 99   (req: < 5)
Gene RIFs: 14   (req: <= 3)
Antibodies: 339   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 99   (req: >= 5)
Gene RIFs: 14   (req: > 3)
Antibodies: 339   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 14
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (4)
Cellular response to heat stress (R-HSA-3371556)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cellular response to heat stress
Reactome
Cellular responses to external stimuli
Reactome
Cellular responses to stress
Reactome
Regulation of HSF1-mediated heat shock response
Name
Explore in Pharos
Explore in Source
Cellular response to heat stress
Cellular responses to external stimuli
Cellular responses to stress
Regulation of HSF1-mediated heat shock response
Gene Ontology Terms (18)
Items per page:
10
1 – 9 of 9
GO Term
Evidence
Assigned by
Traceable Author Statement (TAS)
ProtInc
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
InterPro
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (76)
1 – 10 of 76
HSPA8
Tchem
Novelty: 0.00100906
Score: 0.981
Data Source: STRINGDB
HSPA4
Tbio
Novelty: 0.00010789
Score: 0.981
Data Source: STRINGDB
HSPA1A
Tchem
Novelty: 0.00057437
Score: 0.962
Data Source: STRINGDB
HSPA9
Tbio
Novelty: 0.00133867
Score: 0.942
Data Source: STRINGDB
HSPA1B
Tbio
Novelty: 0.01920833
Score: 0.931
Data Source: STRINGDB
HSPA5
Tchem
Novelty: 0.00051387
Score: 0.93
Data Source: STRINGDB
HSPA12B
Tbio
Novelty: 0.09214127
Score: 0.924
Data Source: STRINGDB
HSPA6
Tbio
Novelty: 0.01015319
Score: 0.92
Data Source: STRINGDB
HSPA1L
Tbio
Novelty: 0.02076021
Score: 0.92
Data Source: STRINGDB
HSPA14
Tbio
Novelty: 0.02550605
Score: 0.92
Data Source: STRINGDB
Publication Statistics
PubMed Score  99.00

PubMed score by year
PubTator Score  77.27

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MDPRKVNELRAFVKMCKQDPSVLHTEEMRFLREWVESMGGKVPPATQKAKSEENTKEEKPDSKKVEEDLK
1-70
ADEPSSEESDLEIDKEGVIEPDTDAPQEMGDENAEITEEMMDQANDKKVAAIEALNDGELQKAIDLFTDA
70-140
IKLNPRLAILYAKRASVFVKLQKPNAAIRDCDRAIEINPDSAQPYKWRGKAHRLLGHWEEAAHDLALACK
140-210
LDYDEDASAMLKEVQPRAQKIAEHRRKYERKREEREIKERIERVKKAREEHERAQREEEARRQSGAQYGS
210-280
FPGGFPGGMPGNFPGGMPGMGGGMPGMAGMPGLNEILSDPEVLAAMQDPEVMVAFQDVAQNPANMSKYQS
280-350
NPKVMNLISKLSAKFGGQA
350-369
MDPRKVNELRAFVKMCKQDPSVLHTEEMRFLREWVESMGGKVPPATQKAKSEENTKEEKPDSKKVEEDLKADEPSSEESDLEIDKEGVIEPDTDAPQEMGDENAEITEEMMDQANDKKVAAIEALNDGELQKAIDLFTDAIKLNPRLAILYAKRASVFVKLQKPNAAIRDCDRAIEINPDSAQPYKWRGKAHRLLGHWEEAAHDLALACKLDYDEDASAMLKEVQPRAQKIAEHRRKYERKREEREIKERIERVKKAREEHERAQREEEARRQSGAQYGSFPGGFPGGMPGNFPGGMPGMGGGMPGMAGMPGLNEILSDPEVLAAMQDPEVMVAFQDVAQNPANMSKYQSNPKVMNLISKLSAKFGGQA