You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
APOH
Beta-2-glycoprotein 1

Protein Summary
Description
Binds to various kinds of negatively charged substances such as heparin, phospholipids, and dextran sulfate. May prevent activation of the intrinsic blood coagulation cascade by binding to phospholipids on the surface of damaged cells. Apolipoprotein H has been implicated in a variety of physiologic pathways including lipoprotein metabolism, coagulation, and the production of antiphospholipid autoantibodies. APOH may be a required cofactor for anionic phospholipid binding by the antiphospholipid autoantibodies found in sera of many patients with lupus and primary antiphospholipid syndrome, but it does not seem to be required for the reactivity of antiphospholipid autoantibodies associated with infections. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000205948
  • ENSP00000205948
  • ENSG00000091583

Symbol
  • B2G1
  • BG
  • B2G1
  • B2GP1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological term
0.94
biological process
0.8
disease
0.69
molecular function
0.63
cell line
0.59


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1690.46   (req: < 5)
Gene RIFs: 167   (req: <= 3)
Antibodies: 502   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1690.46   (req: >= 5)
Gene RIFs: 167   (req: > 3)
Antibodies: 502   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 20
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (7)
1 – 5 of 7
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (5)
Hemostasis (R-HSA-109582)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Hemostasis
Reactome
Platelet activation, signaling and aggregation
Reactome
Platelet degranulation
Reactome
Response to elevated platelet cytosolic Ca2+
Name
Explore in Pharos
Explore in Source
Hemostasis
Platelet activation, signaling and aggregation
Platelet degranulation
Response to elevated platelet cytosolic Ca2+
Protein-Protein Interactions (139)
1 – 10 of 139
FLNA
Tbio
Novelty: 0.00038205
p_int: 0.921516266
p_ni: 0.078483734
Score: 0.485
Data Source: BioPlex,STRINGDB
APOA1
Tbio
Novelty: 0.0001431
Score: 0.981
Data Source: STRINGDB
APOC3
Tclin
Novelty: 0.00116356
Score: 0.978
Data Source: STRINGDB
APOB
Tchem
Novelty: 0.00010107
Score: 0.973
Data Source: STRINGDB
AHSG
Tbio
Novelty: 0.00097441
Score: 0.97
Data Source: STRINGDB
APOA2
Tbio
Novelty: 0.00133324
Score: 0.97
Data Source: STRINGDB
F2
Tclin
Family: Enzyme
Novelty: 0.00006072
Score: 0.962
Data Source: STRINGDB
ITIH3
Tbio
Novelty: 0.05958095
Score: 0.956
Data Source: STRINGDB
AMBP
Tbio
Novelty: 0.00235331
Score: 0.954
Data Source: STRINGDB
ITIH4
Tbio
Novelty: 0.00040286
Score: 0.949
Data Source: STRINGDB
Publication Statistics
PubMed Score  1690.46

PubMed score by year
PubTator Score  1331.38

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MISPVLILFSSFLCHVAIAGRTCPKPDDLPFSTVVPLKTFYEPGEEITYSCKPGYVSRGGMRKFICPLTG
1-70
LWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGADSAKCTEEGKWSPELPVCAPI
70-140
ICPPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHGNWTKLPECREVKCPFPSR
140-210
PDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERV
210-280
KIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC
280-345
MISPVLILFSSFLCHVAIAGRTCPKPDDLPFSTVVPLKTFYEPGEEITYSCKPGYVSRGGMRKFICPLTGLWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGADSAKCTEEGKWSPELPVCAPIICPPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHGNWTKLPECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC