You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
DLL3
Delta-like protein 3

Protein Summary
Description
Inhibits primary neurogenesis. May be required to divert neurons along a specific differentiation pathway. Plays a role in the formation of somite boundaries during segmentation of the paraxial mesoderm (By similarity). This gene encodes a member of the delta protein ligand family. This family functions as Notch ligands that are characterized by a DSL domain, EGF repeats, and a transmembrane domain. Mutations in this gene cause autosomal recessive spondylocostal dysostosis 1. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000205143
  • ENSP00000205143
  • ENSG00000090932
  • ENST00000356433
  • ENSP00000348810

Symbol
  • SCDO1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
cell type or tissue
0.76
gene perturbation
0.66
histone modification site profile
0.66
protein domain
0.58
PubMedID
0.57


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 60.25   (req: < 5)
Gene RIFs: 13   (req: <= 3)
Antibodies: 256   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 60.25   (req: >= 5)
Gene RIFs: 13   (req: > 3)
Antibodies: 256   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 8
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (23)
Items per page:
1 – 5 of 5
Data Source
Name
Explore in Pharos
Explore in Source
KEGG
Endocrine resistance
KEGG
Breast cancer
KEGG
Th1 and Th2 cell differentiation
KEGG
Pathways in cancer
KEGG
Notch signaling pathway
Name
Explore in Pharos
Explore in Source
Endocrine resistance
Breast cancer
Th1 and Th2 cell differentiation
Pathways in cancer
Notch signaling pathway
Gene Ontology Terms (9)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Non-traceable Author Statement (NAS)
UniProtKB
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (50)
1 – 10 of 50
NOTCH1
Tchem
Novelty: 0.00014278
Score: 0.932
Data Source: STRINGDB
JAG1
Tbio
Novelty: 0.00084654
Score: 0.925
Data Source: STRINGDB
DLL1
Tbio
Novelty: 0.00146023
Score: 0.918
Data Source: STRINGDB
NOTCH3
Tchem
Novelty: 0.00119412
Score: 0.854
Data Source: STRINGDB
DLL4
Tbio
Novelty: 0.00339028
Score: 0.839
Data Source: STRINGDB
RBPJ
Tbio
Family: TF
Novelty: 0.00198074
Score: 0.784
Data Source: STRINGDB
HES7
Tbio
Family: TF
Novelty: 0.02394408
Score: 0.74
Data Source: STRINGDB
MESP2
Tbio
Family: TF
Novelty: 0.03686415
Score: 0.718
Data Source: STRINGDB
NOTCH4
Tchem
Novelty: 0.00620485
Score: 0.712
Data Source: STRINGDB
LFNG
Tbio
Family: Enzyme
Novelty: 0.03292217
Score: 0.712
Data Source: STRINGDB
Publication Statistics
PubMed Score  60.25

PubMed score by year
PubTator Score  69.25

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MVSPRMSGLLSQTVILALIFLPQTRPAGVFELQIHSFGPGPGPGAPRSPCSARLPCRLFFRVCLKPGLSE
1-70
EAAESPCALGAALSARGPVYTEQPGAPAPDLPLPDGLLQVPFRDAWPGTFSFIIETWREELGDQIGGPAW
70-140
SLLARVAGRRRLAAGGPWARDIQRAGAWELRFSYRARCEPPAVGTACTRLCRPRSAPSRCGPGLRPCAPL
140-210
EDECEAPLVCRAGCSPEHGFCEQPGECRCLEGWTGPLCTVPVSTSSCLSPRGPSSATTGCLVPGPGPCDG
210-280
NPCANGGSCSETPRSFECTCPRGFYGLRCEVSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNC
280-350
EKRVDRCSLQPCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCALG
350-420
FGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQR
420-490
YLLPPALGLLVAAGVAGAALLLVHVRRRGHSQDAGSRLLAGTPEPSVHALPDALNNLRTQEGSGDGPSSS
490-560
VDWNRPEDVDPQGIYVISAPSIYAREVATPLFPPLHTGRAGQRQHLLFPYPSSILSVK
560-618
MVSPRMSGLLSQTVILALIFLPQTRPAGVFELQIHSFGPGPGPGAPRSPCSARLPCRLFFRVCLKPGLSEEAAESPCALGAALSARGPVYTEQPGAPAPDLPLPDGLLQVPFRDAWPGTFSFIIETWREELGDQIGGPAWSLLARVAGRRRLAAGGPWARDIQRAGAWELRFSYRARCEPPAVGTACTRLCRPRSAPSRCGPGLRPCAPLEDECEAPLVCRAGCSPEHGFCEQPGECRCLEGWTGPLCTVPVSTSSCLSPRGPSSATTGCLVPGPGPCDGNPCANGGSCSETPRSFECTCPRGFYGLRCEVSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSLQPCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCALGFGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYLLPPALGLLVAAGVAGAALLLVHVRRRGHSQDAGSRLLAGTPEPSVHALPDALNNLRTQEGSGDGPSSSVDWNRPEDVDPQGIYVISAPSIYAREVATPLFPPLHTGRAGQRQHLLFPYPSSILSVK