You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
CLDN11
Claudin-11

Protein Summary
Description
Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity. This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. The protein encoded by this gene is a major component of central nervous system (CNS) myelin and plays an important role in regulating proliferation and migration of oligodendrocytes. Mouse studies showed that the gene deficiency results in deafness and loss of the Sertoli cell epithelial phenotype in the testis. This protein is a tight junction protein at the human blood-testis barrier (BTB), and the BTB disruption is related to a dysfunction of this gene. Alter ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000064724
  • ENSP00000064724
  • ENSG00000013297

Symbol
  • OSP
  • OTM
  • OSP
  • OTM
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
drug perturbation
0.87
microRNA
0.77
small molecule perturbation
0.69
PubMedID
0.68
cell type or tissue
0.64


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 387.9   (req: < 5)
Gene RIFs: 18   (req: <= 3)
Antibodies: 301   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 387.9   (req: >= 5)
Gene RIFs: 18   (req: > 3)
Antibodies: 301   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 3
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (25)
Cell junction organization (R-HSA-446728)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cell junction organization
Reactome
Cell-Cell communication
Reactome
Cell-cell junction organization
Reactome
Tight junction interactions
Name
Explore in Pharos
Explore in Source
Cell junction organization
Cell-Cell communication
Cell-cell junction organization
Tight junction interactions
Gene Ontology Terms (6)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (67)
1 – 10 of 67
CLDN12
Tbio
Novelty: 0.06470623
Score: 0.956
Data Source: STRINGDB
CLDN23
Tbio
Novelty: 0.16372511
Score: 0.947
Data Source: STRINGDB
CLDN14
Tbio
Novelty: 0.02451529
Score: 0.922
Data Source: STRINGDB
CLDN16
Tbio
Novelty: 0.0103486
Score: 0.92
Data Source: STRINGDB
CLDN5
Tbio
Novelty: 0.00230537
Score: 0.919
Data Source: STRINGDB
CLDN2
Tbio
Novelty: 0.00319519
Score: 0.917
Data Source: STRINGDB
CLDN6
Tbio
Novelty: 0.01627077
Score: 0.917
Data Source: STRINGDB
CLDN9
Tbio
Novelty: 0.10826674
Score: 0.916
Data Source: STRINGDB
CLDN3
Tbio
Novelty: 0.00374279
Score: 0.916
Data Source: STRINGDB
CLDN19
Tbio
Novelty: 0.03007126
Score: 0.916
Data Source: STRINGDB
Publication Statistics
PubMed Score  387.90

PubMed score by year
PubTator Score  119.32

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MVATCLQVVGFVTSFVGWIGVIVTTSTNDWVVTCGYTIPTCRKLDELGSKGLWADCVMATGLYHCKPLVD
1-70
ILILPGYVQACRALMIAASVLGLPAILLLLTVLPCIRMGQEPGVAKYRRAQLAGVLLILLALCALVATIW
70-140
FPVCAHRETTIVSFGYSLYAGWIGAVLCLVGGCVILCCAGDAQAFGENRFYYTAGSSSPTHAKSAHV
140-207
MVATCLQVVGFVTSFVGWIGVIVTTSTNDWVVTCGYTIPTCRKLDELGSKGLWADCVMATGLYHCKPLVDILILPGYVQACRALMIAASVLGLPAILLLLTVLPCIRMGQEPGVAKYRRAQLAGVLLILLALCALVATIWFPVCAHRETTIVSFGYSLYAGWIGAVLCLVGGCVILCCAGDAQAFGENRFYYTAGSSSPTHAKSAHV