You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
TNFRSF17
Tumor necrosis factor receptor superfamily member 17

Protein Summary
Description
Receptor for TNFSF13B/BLyS/BAFF and TNFSF13/APRIL. Promotes B-cell survival and plays a role in the regulation of humoral immunity. Activates NF-kappa-B and JNK. The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is preferentially expressed in mature B lymphocytes, and may be important for B cell development and autoimmune response. This receptor has been shown to specifically bind to the tumor necrosis factor (ligand) superfamily, member 13b (TNFSF13B/TALL-1/BAFF), and to lead to NF-kappaB and MAPK8/JNK activation. This receptor also binds to various TRAF family members, and thus may transduce signals for cell survival and proliferation. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000053243
  • ENSP00000053243
  • ENSG00000048462
  • ENST00000396495
  • ENSP00000379753

Symbol
  • BCM
  • BCMA
  • BCM
  • BCMA
  • CD269
  • TNFRSF13A
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
PubMedID
0.8
gene perturbation
0.57
biological term
0.52
tissue
0.49
kinase perturbation
0.48


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 575.84   (req: < 5)
Gene RIFs: 40   (req: <= 3)
Antibodies: 546   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 575.84   (req: >= 5)
Gene RIFs: 40   (req: > 3)
Antibodies: 546   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 7
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (4)
1 – 4 of 4
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (7)
Cytokine Signaling in Immune system (R-HSA-1280215)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cytokine Signaling in Immune system
Reactome
Immune System
Reactome
TNFR2 non-canonical NF-kB pathway
Reactome
TNFs bind their physiological receptors
Name
Explore in Pharos
Explore in Source
Cytokine Signaling in Immune system
Immune System
TNFR2 non-canonical NF-kB pathway
TNFs bind their physiological receptors
Gene Ontology Terms (10)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Traceable Author Statement (TAS)
ProtInc
Protein-Protein Interactions (50)
1 – 10 of 50
OTULINL
Tdark
Family: Enzyme
Novelty: 0.3559322
p_int: 0.999996652
p_ni: 0.000001565
p_wrong: 0.000001784
Score: 0.359
Data Source: BioPlex,STRINGDB
FAM171A1
Tdark
Novelty: 1.28695652
p_int: 0.999976048
p_ni: 0.000023952
Score: 0.345
Data Source: BioPlex,STRINGDB
OPA3
Tbio
Novelty: 0.0211259
p_int: 0.999966422
p_ni: 0.000033568
p_wrong: 1e-8
Score: 0.209
Data Source: BioPlex,STRINGDB
CD70
Tbio
Novelty: 0.00552433
p_int: 0.999956133
p_ni: 0.000012136
p_wrong: 0.000031731
Score: 0.353
Data Source: BioPlex,STRINGDB
PRKN
Tbio
Family: Enzyme
Novelty: 0.00092228
p_int: 0.999721603
p_ni: 0.000277752
p_wrong: 6.45e-7
Score: 0.232
Data Source: BioPlex,STRINGDB
TARBP1
Tbio
Family: Enzyme
Novelty: 0.05123097
p_int: 0.999686467
p_ni: 0.000313533
Score: 0.213
Data Source: BioPlex,STRINGDB
ZMPSTE24
Tbio
Family: Enzyme
Novelty: 0.00353005
p_int: 0.997526573
p_ni: 0.002473358
p_wrong: 6.9e-8
Score: 0.177
Data Source: BioPlex,STRINGDB
TSPAN6
Tbio
Novelty: 0.08368309
p_int: 0.984894402
p_ni: 0.007555902
p_wrong: 0.007549696
Score: 0.163
Data Source: BioPlex,STRINGDB
INTS7
Tdark
Novelty: 0.11980396
p_int: 0.881736248
p_ni: 0.118262185
p_wrong: 0.000001567
Score: 0.183
Data Source: BioPlex,STRINGDB
AGPAT1
Tbio
Family: Enzyme
Novelty: 0.08786232
p_int: 0.761330869
p_ni: 0.238669122
p_wrong: 9e-9
Score: 0.209
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  575.84

PubMed score by year
PubTator Score  178.63

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNAILWTCLGLSLIISLAV
1-70
FVLMFLLRKINSEPLKDEFKNTGSGLLGMANIDLEKSRTGDEIILPRGLEYTVEECTCEDCIKSKPKVDS
70-140
DHCFPLPAMEEGATILVTTKTNDYCKSLPAALSATEIEKSISAR
140-184
MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNAILWTCLGLSLIISLAVFVLMFLLRKINSEPLKDEFKNTGSGLLGMANIDLEKSRTGDEIILPRGLEYTVEECTCEDCIKSKPKVDSDHCFPLPAMEEGATILVTTKTNDYCKSLPAALSATEIEKSISAR