You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
TTC17
Tetratricopeptide repeat protein 17

Protein Summary
Description
Plays a role in primary ciliogenesis by modulating actin polymerization.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000039989
  • ENSP00000039989
  • ENSG00000052841
  • ENST00000299240
  • ENSP00000299240
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
kinase perturbation
0.97
virus perturbation
0.96
disease perturbation
0.87
transcription factor perturbation
0.74
histone modification site profile
0.69


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1.92   (req: < 5)
Gene RIFs: 2   (req: <= 3)
Antibodies: 37   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1.92   (req: >= 5)
Gene RIFs: 2   (req: > 3)
Antibodies: 37   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 2
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (6)
Items per page:
10
1 – 4 of 4
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
HPA
Inferred from Direct Assay (IDA)
UniProtKB
Protein-Protein Interactions (50)
1 – 10 of 50
TNFSF13B
Tclin
Novelty: 0.00048014
p_int: 0.999433329
p_ni: 0.000566671
Data Source: BioPlex
LYZL1
Tdark
Family: Enzyme
Novelty: 0.21384929
p_int: 0.998088946
p_ni: 0.001911054
Data Source: BioPlex
GRAMD1B
Tdark
Novelty: 0.34994698
p_int: 0.992280635
p_ni: 0.007719365
Data Source: BioPlex
CSTL1
Tdark
Novelty: 0.27027027
p_int: 0.988776567
p_ni: 0.011223433
Data Source: BioPlex
LYZL2
Tdark
Family: Enzyme
Novelty: 1.38461538
p_int: 0.984477929
p_ni: 0.015522071
Data Source: BioPlex
MCOLN3
Tchem
Family: IC
Novelty: 0.05172316
p_int: 0.974434748
p_ni: 0.025565252
Data Source: BioPlex
ADAM33
Tchem
Family: Enzyme
Novelty: 0.00627958
p_int: 0.972803524
p_ni: 0.027196476
Data Source: BioPlex
GABRD
Tclin
Family: IC
Novelty: 0.03079565
p_int: 0.968787854
p_ni: 0.031212146
Data Source: BioPlex
GABRA3
Tclin
Family: IC
Novelty: 0.02993035
p_int: 0.967403573
p_ni: 0.032596427
Data Source: BioPlex
GABRE
Tclin
Family: IC
Novelty: 0.09719489
p_int: 0.963435531
p_ni: 0.036564469
Data Source: BioPlex
Publication Statistics
PubMed Score  1.92

PubMed score by year
PubTator Score  2.08

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAAAVGVRGRYELPPCSGPGWLLSLSALLSVAARGAFATTHWVVTEDGKIQQQVDSPMNLKHPHDLVILM
1-70
RQEATVNYLKELEKQLVAQKIHIEENEDRDTGLEQRHNKEDPDCIKAKVPLGDLDLYDGTYITLESKDIS
70-140
PEDYIDTESPVPPDPEQPDCTKILELPYSIHAFQHLRGVQERVNLSAPLLPKEDPIFTYLSKRLGRSIDD
140-210
IGHLIHEGLQKNTSSWVLYNMASFYWRIKNEPYQVVECAMRALHFSSRHNKDIALVNLANVLHRAHFSAD
210-280
AAVVVHAALDDSDFFTSYYTLGNIYAMLGEYNHSVLCYDHALQARPGFEQAIKRKHAVLCQQKLEQKLEA
280-350
QHRSLQRTLNELKEYQKQHDHYLRQQEILEKHKLIQEEQILRNIIHETQMAKEAQLGNHQICRLVNQQHS
350-420
LHCQWDQPVRYHRGDIFENVDYVQFGEDSSTSSMMSVNFDVQSNQSDINDSVKSSPVAHSILWIWGRDSD
420-490
AYRDKQHILWPKRADCTESYPRVPVGGELPTYFLPPENKGLRIHELSSDDYSTEEEAQTPDCSITDFRKS
490-560
HTLSYLVKELEVRMDLKAKMPDDHARKILLSRINNYTIPEEEIGSFLFHAINKPNAPIWLILNEAGLYWR
560-630
AVGNSTFAIACLQRALNLAPLQYQDVPLVNLANLLIHYGLHLDATKLLLQALAINSSEPLTFLSLGNAYL
630-700
ALKNISGALEAFRQALKLTTKCPECENSLKLIRCMQFYPFLYNITSSVCSGTVVEESNGSDEMENSDETK
700-770
MSEEILALVDEFQQAWPLEGFGGALEMKGRRLDLQGIRVLKKGPQDGVARSSCYGDCRSEDDEATEWITF
770-840
QVKRVKKPKGDHKKTPGKKVETGQIENGHRYQANLEITGPKVASPGPQGKKRDYQRLGWPSPDECLKLRW
840-910
VELTAIVSTWLAVSSKNIDITEHIDFATPIQQPAMEPLCNGNLPTSMHTLDHLHGVSNRASLHYTGESQL
910-980
TEVLQNLGKDQYPQQSLEQIGTRIAKVLEKNQTSWVLSSMAALYWRVKGQGKKAIDCLRQALHYAPHQMK
980-1050
DVPLISLANILHNAKLWNDAVIVATMAVEIAPHFAVNHFTLGNVYVAMEEFEKALVWYESTLKLQPEFVP
1050-1120
AKNRIQTIQCHLMLKKGRRSP
1120-1141
MAAAVGVRGRYELPPCSGPGWLLSLSALLSVAARGAFATTHWVVTEDGKIQQQVDSPMNLKHPHDLVILMRQEATVNYLKELEKQLVAQKIHIEENEDRDTGLEQRHNKEDPDCIKAKVPLGDLDLYDGTYITLESKDISPEDYIDTESPVPPDPEQPDCTKILELPYSIHAFQHLRGVQERVNLSAPLLPKEDPIFTYLSKRLGRSIDDIGHLIHEGLQKNTSSWVLYNMASFYWRIKNEPYQVVECAMRALHFSSRHNKDIALVNLANVLHRAHFSADAAVVVHAALDDSDFFTSYYTLGNIYAMLGEYNHSVLCYDHALQARPGFEQAIKRKHAVLCQQKLEQKLEAQHRSLQRTLNELKEYQKQHDHYLRQQEILEKHKLIQEEQILRNIIHETQMAKEAQLGNHQICRLVNQQHSLHCQWDQPVRYHRGDIFENVDYVQFGEDSSTSSMMSVNFDVQSNQSDINDSVKSSPVAHSILWIWGRDSDAYRDKQHILWPKRADCTESYPRVPVGGELPTYFLPPENKGLRIHELSSDDYSTEEEAQTPDCSITDFRKSHTLSYLVKELEVRMDLKAKMPDDHARKILLSRINNYTIPEEEIGSFLFHAINKPNAPIWLILNEAGLYWRAVGNSTFAIACLQRALNLAPLQYQDVPLVNLANLLIHYGLHLDATKLLLQALAINSSEPLTFLSLGNAYLALKNISGALEAFRQALKLTTKCPECENSLKLIRCMQFYPFLYNITSSVCSGTVVEESNGSDEMENSDETKMSEEILALVDEFQQAWPLEGFGGALEMKGRRLDLQGIRVLKKGPQDGVARSSCYGDCRSEDDEATEWITFQVKRVKKPKGDHKKTPGKKVETGQIENGHRYQANLEITGPKVASPGPQGKKRDYQRLGWPSPDECLKLRWVELTAIVSTWLAVSSKNIDITEHIDFATPIQQPAMEPLCNGNLPTSMHTLDHLHGVSNRASLHYTGESQLTEVLQNLGKDQYPQQSLEQIGTRIAKVLEKNQTSWVLSSMAALYWRVKGQGKKAIDCLRQALHYAPHQMKDVPLISLANILHNAKLWNDAVIVATMAVEIAPHFAVNHFTLGNVYVAMEEFEKALVWYESTLKLQPEFVPAKNRIQTIQCHLMLKKGRRSP