You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
ERCC1
DNA excision repair protein ERCC-1

Protein Summary
Description
Isoform 1: Non-catalytic component of a structure-specific DNA repair endonuclease responsible for the 5'-incision during DNA repair. Responsible, in conjunction with SLX4, for the first step in the repair of interstrand cross-links (ICL). Participates in the processing of anaphase bridge-generating DNA structures, which consist in incompletely processed DNA lesions arising during S or G2 phase, and can result in cytokinesis failure. Also required for homology-directed repair (HDR) of DNA double-strand breaks, in conjunction with SLX4. The product of this gene functions in the nucleotide excision repair pathway, and is required for the repair of DNA lesions such as those induced by UV light or formed by electrophilic compounds including cisplatin. The encoded protein forms a heterodimer with the XPF endonuclease (also known as ERCC4), and the heterodimeric endonuclease catalyzes the 5' incision in the process of excising the DNA lesion. The heterodimeric endonuclease is also involved i ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000013807
  • ENSP00000013807
  • ENSG00000012061
  • ENST00000300853
  • ENSP00000300853
  • ENST00000340192
  • ENSP00000345203
  • ENST00000423698
  • ENSP00000394875
  • ENST00000589165
  • ENSP00000468035

Symbol
  • UV20
  • COFS4
  • RAD10
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological term
0.99
disease perturbation
0.96
kinase perturbation
0.96
transcription factor perturbation
0.94
biological process
0.93


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1157.11   (req: < 5)
Gene RIFs: 463   (req: <= 3)
Antibodies: 1117   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1157.11   (req: >= 5)
Gene RIFs: 463   (req: > 3)
Antibodies: 1117   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 44
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (6)
1 – 5 of 6
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (15)
DNA Double-Strand Break Repair (R-HSA-5693532)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 12
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
DNA Double-Strand Break Repair
Reactome
DNA Repair
Reactome
Dual Incision in GG-NER
Reactome
Dual incision in TC-NER
Reactome
Fanconi Anemia Pathway
Name
Explore in Pharos
Explore in Source
DNA Double-Strand Break Repair
DNA Repair
Dual Incision in GG-NER
Dual incision in TC-NER
Fanconi Anemia Pathway
Gene Ontology Terms (51)
Items per page:
10
1 – 6 of 6
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (283)
1 – 10 of 283
SLX4
Tbio
Family: Enzyme
Novelty: 0.01974743
p_int: 0.999999999
p_ni: 1e-9
Score: 0.997
Data Source: BioPlex,STRINGDB
ERCC4
Tbio
Family: Enzyme
Novelty: 0.01444679
p_int: 0.999999981
p_ni: 1.8e-8
p_wrong: 1e-9
Score: 0.999
Data Source: BioPlex,Reactome,STRINGDB
SLX4IP
Tdark
Novelty: 1.13860465
p_int: 0.999996887
p_ni: 0.000003113
Score: 0.605
Data Source: BioPlex,STRINGDB
XPA
Tbio
Novelty: 0.00128557
p_int: 0.999986073
p_ni: 0.000012422
p_wrong: 0.000001504
Score: 0.999
Data Source: BioPlex,STRINGDB
MAGIX
Tdark
Novelty: 0.09090909
p_int: 0.999771367
p_ni: 0.000228384
p_wrong: 2.49e-7
Score: 0.183
Data Source: BioPlex,STRINGDB
MUS81
Tbio
Family: Enzyme
Novelty: 0.0066722
p_int: 0.985591388
p_ni: 0.000735723
p_wrong: 0.013672889
Score: 0.999
Data Source: BioPlex,STRINGDB
ZFC3H1
Tdark
Novelty: 0.234375
p_int: 0.983600598
p_ni: 0.001285422
p_wrong: 0.01511398
Score: 0.183
Data Source: BioPlex,STRINGDB
SLX1A
Tbio
Family: Enzyme
Novelty: 0.06062939
p_int: 0.91313037
p_ni: 0.000009168
p_wrong: 0.086860462
Score: 0.905
Data Source: BioPlex,STRINGDB
RAD1
Tchem
Novelty: 0.01108306
Score: 0.999
Data Source: STRINGDB
MSH2
Tbio
Novelty: 0.00062722
Score: 0.997
Data Source: STRINGDB
Publication Statistics
PubMed Score  1157.11

PubMed score by year
PubTator Score  1029.68

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MDPGKDKEGVPQPSGPPARKKFVIPLDEDEVPPGVAKPLFRSTQSLPTVDTSAQAAPQTYAEYAISQPLE
1-70
GAGATCPTGSEPLAGETPNQALKPGAKSNSIIVSPRQRGNPVLKFVRNVPWEFGDVIPDYVLGQSTCALF
70-140
LSLRYHNLHPDYIHGRLQSLGKNFALRVLLVQVDVKDPQQALKELAKMCILADCTLILAWSPEEAGRYLE
140-210
TYKAYEQKPADLLMEKLEQDFVSRVTECLTTVKSVNKTDSQTLLTTFGSLEQLIAASREDLALCPGLGPQ
210-280
KARRLFDVLHEPFLKVP
280-297
MDPGKDKEGVPQPSGPPARKKFVIPLDEDEVPPGVAKPLFRSTQSLPTVDTSAQAAPQTYAEYAISQPLEGAGATCPTGSEPLAGETPNQALKPGAKSNSIIVSPRQRGNPVLKFVRNVPWEFGDVIPDYVLGQSTCALFLSLRYHNLHPDYIHGRLQSLGKNFALRVLLVQVDVKDPQQALKELAKMCILADCTLILAWSPEEAGRYLETYKAYEQKPADLLMEKLEQDFVSRVTECLTTVKSVNKTDSQTLLTTFGSLEQLIAASREDLALCPGLGPQKARRLFDVLHEPFLKVP