You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
CD4
T-cell surface glycoprotein CD4

Protein Summary
Description
Integral membrane glycoprotein that plays an essential role in the immune response and serves multiple functions in responses against both external and internal offenses. In T-cells, functions primarily as a coreceptor for MHC class II molecule:peptide complex. The antigens presented by class II peptides are derived from extracellular proteins while class I peptides are derived from cytosolic proteins. Interacts simultaneously with the T-cell receptor (TCR) and the MHC class II presented by antigen presenting cells (APCs). In turn, recruits the Src kinase LCK to the vicinity of the TCR-CD3 complex. LCK then initiates different intracellular signaling pathways by phosphorylating various substrates ultimately leading to lymphokine production, motility, adhesion and activation of T-helper cells. In other cells such as macrophages or NK cells, plays a role in differentiation/activation, cytokine expression and cell migration in a TCR/LCK-independent pathway. Participates in the development ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000011653
  • ENSP00000011653
  • ENSG00000010610

Symbol
  • CD4mut
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0.98
protein domain
0.97
virus
0.89
molecular function
0.88
disease
0.83


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1240.68   (req: < 5)
Gene RIFs: 284   (req: <= 3)
Antibodies: 5688   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1240.68   (req: >= 5)
Gene RIFs: 284   (req: > 3)
Antibodies: 5688   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 56
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 3
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 1
Approved Drugs (1)
1 – 1 of 1
ibalizumab
no chemical structure image available
Protein Data Bank (60)
1 – 5 of 60
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (185)
Adaptive Immune System (R-HSA-1280218)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 31
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Adaptive Immune System
Reactome
Alpha-defensins
Reactome
Antimicrobial peptides
Reactome
Binding and entry of HIV virion
Reactome
Cargo recognition for clathrin-mediated endocytosis
Name
Explore in Pharos
Explore in Source
Adaptive Immune System
Alpha-defensins
Antimicrobial peptides
Binding and entry of HIV virion
Cargo recognition for clathrin-mediated endocytosis
Gene Ontology Terms (65)
Items per page:
10
1 – 10 of 15
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
CAFA
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Physical Interaction (IPI)
IntAct
Inferred from Physical Interaction (IPI)
CAFA
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Physical Interaction (IPI)
UniProtKB
Traceable Author Statement (TAS)
ProtInc
Protein-Protein Interactions (343)
1 – 10 of 343
KIAA0319L
Tbio
Novelty: 0.04651519
p_int: 0.993327496
p_ni: 0.006655012
p_wrong: 0.000017492
Data Source: BioPlex
POGZ
Tbio
Novelty: 0.0652799
p_int: 0.992524011
p_ni: 0.007475889
p_wrong: 9.9e-8
Score: 0.187
Data Source: BioPlex,STRINGDB
TMEM11
Tbio
Novelty: 0.00132758
p_int: 0.963109631
p_ni: 0.02089222
p_wrong: 0.015998148
Score: 0.292
Data Source: BioPlex,STRINGDB
ATP6V0A2
Tbio
Family: Enzyme
Novelty: 0.0033925
p_int: 0.95437548
p_ni: 0.04562452
Data Source: BioPlex
CCDC85C
Tdark
Novelty: 0.24539877
p_int: 0.930452032
p_ni: 0.069547968
Data Source: BioPlex
ARV1
Tbio
Novelty: 0.04386172
p_int: 0.900144953
p_ni: 0.099765879
p_wrong: 0.000089168
Score: 0.185
Data Source: BioPlex,STRINGDB
VAMP3
Tbio
Novelty: 0.00974462
p_int: 0.882464048
p_ni: 0.117535914
p_wrong: 3.8e-8
Score: 0.91
Data Source: BioPlex,STRINGDB
ATP6V0A1
Tbio
Family: Enzyme
Novelty: 0.03404906
p_int: 0.879716363
p_ni: 0.120283637
Data Source: BioPlex
EIF2B3
Tbio
Novelty: 0.05806987
p_int: 0.818811552
p_ni: 0.181188448
Data Source: BioPlex
SAAL1
Tdark
Novelty: 0.4
p_int: 0.810497501
p_ni: 0.189502499
Data Source: BioPlex
Publication Statistics
PubMed Score  1240.68

PubMed score by year
PubTator Score  38376.69

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MNRGVPFRHLLLVLQLALLPAATQGKKVVLGKKGDTVELTCTASQKKSIQFHWKNSNQIKILGNQGSFLT
1-70
KGPSKLNDRADSRRSLWDQGNFPLIIKNLKIEDSDTYICEVEDQKEEVQLLVFGLTANSDTHLLQGQSLT
70-140
LTLESPPGSSPSVQCRSPRGKNIQGGKTLSVSQLELQDSGTWTCTVLQNQKKVEFKIDIVVLAFQKASSI
140-210
VYKKEGEQVEFSFPLAFTVEKLTGSGELWWQAERASSSKSWITFDLKNKEVSVKRVTQDPKLQMGKKLPL
210-280
HLTLPQALPQYAGSGNLTLALEAKTGKLHQEVNLVVMRATQLQKNLTCEVWGPTSPKLMLSLKLENKEAK
280-350
VSKREKAVWVLNPEAGMWQCLLSDSGQVLLESNIKVLPTWSTPVQPMALIVLGGVAGLLLFIGLGIFFCV
350-420
RCRHRRRQAERMSQIKRLLSEKKTCQCPHRFQKTCSPI
420-458
MNRGVPFRHLLLVLQLALLPAATQGKKVVLGKKGDTVELTCTASQKKSIQFHWKNSNQIKILGNQGSFLTKGPSKLNDRADSRRSLWDQGNFPLIIKNLKIEDSDTYICEVEDQKEEVQLLVFGLTANSDTHLLQGQSLTLTLESPPGSSPSVQCRSPRGKNIQGGKTLSVSQLELQDSGTWTCTVLQNQKKVEFKIDIVVLAFQKASSIVYKKEGEQVEFSFPLAFTVEKLTGSGELWWQAERASSSKSWITFDLKNKEVSVKRVTQDPKLQMGKKLPLHLTLPQALPQYAGSGNLTLALEAKTGKLHQEVNLVVMRATQLQKNLTCEVWGPTSPKLMLSLKLENKEAKVSKREKAVWVLNPEAGMWQCLLSDSGQVLLESNIKVLPTWSTPVQPMALIVLGGVAGLLLFIGLGIFFCVRCRHRRRQAERMSQIKRLLSEKKTCQCPHRFQKTCSPI