You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
M6PR
Cation-dependent mannose-6-phosphate receptor

Protein Classes
Protein Summary
Description
Transport of phosphorylated lysosomal enzymes from the Golgi complex and the cell surface to lysosomes. Lysosomal enzymes bearing phosphomannosyl residues bind specifically to mannose-6-phosphate receptors in the Golgi apparatus and the resulting receptor-ligand complex is transported to an acidic prelyosomal compartment where the low pH mediates the dissociation of the complex. This gene encodes a member of the P-type lectin family. P-type lectins play a critical role in lysosome function through the specific transport of mannose-6-phosphate-containing acid hydrolases from the Golgi complex to lysosomes. The encoded protein functions as a homodimer and requires divalent cations for ligand binding. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. A pseudogene of this gene is located on the long arm of chromosome X. [provided by RefSeq, May 2011]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000000412
  • ENSP00000000412
  • ENSG00000003056

Symbol
  • MPR46
  • MPRD
  • SMPR
  • MPR46
  • CD-MPR
  • MPR 46
  • MPR-46
  • CD-M6PR
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
disease perturbation
0.96
transcription factor perturbation
0.94
cellular component
0.91
transcription factor binding site profile
0.9
histone modification site profile
0.87


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 371.34   (req: < 5)
Gene RIFs: 15   (req: <= 3)
Antibodies: 245   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 371.34   (req: >= 5)
Gene RIFs: 15   (req: > 3)
Antibodies: 245   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 8
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (10)
Cargo recognition for clathrin-mediated endocytosis (R-HSA-8856825)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 8
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cargo recognition for clathrin-mediated endocytosis
Reactome
Clathrin-mediated endocytosis
Reactome
Intra-Golgi and retrograde Golgi-to-ER traffic
Reactome
Lysosome Vesicle Biogenesis
Reactome
Membrane Trafficking
Name
Explore in Pharos
Explore in Source
Cargo recognition for clathrin-mediated endocytosis
Clathrin-mediated endocytosis
Intra-Golgi and retrograde Golgi-to-ER traffic
Lysosome Vesicle Biogenesis
Membrane Trafficking
Protein-Protein Interactions (221)
1 – 10 of 221
FAM19A2
Tdark
Novelty: 0.31987814
p_int: 0.99882542
p_ni: 0.00117458
Data Source: BioPlex
FAM19A4
Tbio
Novelty: 0.04762169
p_int: 0.970888035
p_ni: 0.029111965
Score: 0.19
Data Source: BioPlex,STRINGDB
PATE1
Tbio
Novelty: 0.03158921
p_int: 0.837618109
p_ni: 0.162381891
Data Source: BioPlex
FAM19A1
Tdark
Novelty: 1.07969152
p_int: 0.77682056
p_ni: 0.22317944
Score: 0.485
Data Source: BioPlex,STRINGDB
IGF2R
Tchem
Novelty: 0.00075488
Score: 0.988
Data Source: STRINGDB
PLIN3
Tbio
Novelty: 0.01218096
Score: 0.985
Data Source: STRINGDB
VTI1A
Tbio
Novelty: 0.06028708
Score: 0.97
Data Source: Reactome,STRINGDB
TGOLN2
Tbio
Novelty: 0.00791111
Score: 0.967
Data Source: STRINGDB
RAB5A
Tbio
Family: Enzyme
Novelty: 0.00149542
Score: 0.958
Data Source: STRINGDB
TFRC
Tbio
Novelty: 0.00035547
Score: 0.956
Data Source: STRINGDB
Publication Statistics
PubMed Score  371.34

PubMed score by year
PubTator Score  162.14

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MFPFYSCWRTGLLLLLLAVAVRESWQTEEKTCDLVGEKGKESEKELALVKRLKPLFNKSFESTVGQGSDT
1-70
YIYIFRVCREAGNHTSGAGLVQINKSNGKETVVGRLNETHIFNGSNWIMLIYKGGDEYDNHCGKEQRRAV
70-140
VMISCNRHTLADNFNPVSEERGKVQDCFYLFEMDSSLACSPEISHLSVGSILLVTFASLVAVYVVGGFLY
140-210
QRLVVGAKGMEQFPHLAFWQDLGNLVADGCDFVCRSKPRNVPAAYRGVGDDQLGEESEERDDHLLPM
210-277
MFPFYSCWRTGLLLLLLAVAVRESWQTEEKTCDLVGEKGKESEKELALVKRLKPLFNKSFESTVGQGSDTYIYIFRVCREAGNHTSGAGLVQINKSNGKETVVGRLNETHIFNGSNWIMLIYKGGDEYDNHCGKEQRRAVVMISCNRHTLADNFNPVSEERGKVQDCFYLFEMDSSLACSPEISHLSVGSILLVTFASLVAVYVVGGFLYQRLVVGAKGMEQFPHLAFWQDLGNLVADGCDFVCRSKPRNVPAAYRGVGDDQLGEESEERDDHLLPM