You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
C5orf66
Putative uncharacterized protein C5orf66

Protein Summary
Uniprot Accession IDs
Gene Name
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0
biological term
0
cell line
0
cell type or tissue
0
cellular component
0


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0   (req: < 5)
Gene RIFs: 0   (req: <= 3)
Antibodies: 0   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0   (req: >= 5)
Gene RIFs: 0   (req: > 3)
Antibodies: 0   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 0
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein-Protein Interactions (5)
1 – 5 of 5
TSSC4
Tdark
Novelty: 0.36373657
Score: 0.588
Data Source: STRINGDB
LCN6
Tbio
Novelty: 0.06664903
Score: 0.471
Data Source: STRINGDB
TRPM5
Tchem
Family: IC
Novelty: 0.00964573
Score: 0.447
Data Source: STRINGDB
H2AFY
Tbio
Novelty: 0.0155084
Score: 0.445
Data Source: STRINGDB
PITX1
Tbio
Family: TF
Novelty: 0.00292249
Score: 0.426
Data Source: STRINGDB
Publication Statistics
PubTator Score  2.18

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MGITPWPKGHTEPKGSYSLRKKPCYGTVAALDCAGCQEGMAEAASVGLAQSESTTIMGHVCAERHTHDRY
1-70
VTSMCPYLPLPMDGNAMDFSFLSSARAKQFFTVFSRSSSHLSAPQTGLLQWITNLAGRPWPALTAASGAG
70-140
MKQKQ
140-145
MGITPWPKGHTEPKGSYSLRKKPCYGTVAALDCAGCQEGMAEAASVGLAQSESTTIMGHVCAERHTHDRYVTSMCPYLPLPMDGNAMDFSFLSSARAKQFFTVFSRSSSHLSAPQTGLLQWITNLAGRPWPALTAASGAGMKQKQ