You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
ATXN8OS
Putative protein ATXN8OS

Protein Summary
Description
This gene is an antisense transcript to the KLHL1 gene (homolog to the Drosophila KELCH gene); it does not itself appear to be protein coding. A TAC/TGC trinucleotide repeat expansion that is incorporated into this gene transcript, but not the KLHL1 transcript, causes spinocerebellar ataxia type 8. Presumably the expansion interferes with normal antisense function of this transcript. [provided by RefSeq, Oct 2008]
Uniprot Accession IDs
Gene Name
Symbol
  • KLHL1AS
  • SCA8
  • SCA8
  • KLHL1AS
  • NCRNA00003
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
tissue
0.98
cell type or tissue
0.8
cell line
0.5
disease
0.5
biological term
0.42


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0   (req: < 5)
Gene RIFs: 19   (req: <= 3)
Antibodies: 0   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0   (req: >= 5)
Gene RIFs: 19   (req: > 3)
Antibodies: 0   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 0
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (1)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
UniProtKB-SubCell
Publication Statistics
PubTator Score  7.02

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MPCPGAPCCSLVATGSRVPFSGLKEEEEEDGEDDEEEEEEGFFQKVLTPLLSWLLSRRLWLGPQCSKLPL
1-70
PSCCRQPPPAGPPVEGDGWLKSFQRSRRMCFTSKSFRPEPDMLYAQKAKGWQLTQDSGGWEVQDQCTRIW
70-140
SKENLLALNTHSRRQKGKRENKVCVSTWQKSRGDRTYSSMATTPSMTKILEGCMYRKLKC
140-200
MPCPGAPCCSLVATGSRVPFSGLKEEEEEDGEDDEEEEEEGFFQKVLTPLLSWLLSRRLWLGPQCSKLPLPSCCRQPPPAGPPVEGDGWLKSFQRSRRMCFTSKSFRPEPDMLYAQKAKGWQLTQDSGGWEVQDQCTRIWSKENLLALNTHSRRQKGKRENKVCVSTWQKSRGDRTYSSMATTPSMTKILEGCMYRKLKC