You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
GNAT3
Guanine nucleotide-binding protein G(t) subunit alpha-3

Protein Summary
Description
Guanine nucleotide-binding protein (G protein) alpha subunit playing a prominent role in bitter and sweet taste transduction as well as in umami (monosodium glutamate, monopotassium glutamate, and inosine monophosphate) taste transduction. Transduction by this alpha subunit involves coupling of specific cell-surface receptors with a cGMP-phosphodiesterase; Activation of phosphodiesterase lowers intracellular levels of cAMP and cGMP which may open a cyclic nucleotide-suppressible cation channel leading to influx of calcium, ultimately leading to release of neurotransmitter. Indeed, denatonium and strychnine induce transient reduction in cAMP and cGMP in taste tissue, whereas this decrease is inhibited by GNAT3 antibody. Gustducin heterotrimer transduces response to bitter and sweet compounds via regulation of phosphodiesterase for alpha subunit, as well as via activation of phospholipase C for beta and gamma subunits, with ultimate increase inositol trisphosphate and increase of intrace ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000398291
  • ENSP00000381339
  • ENSG00000214415

Symbol
  • GDCA
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
1
cellular component
0.85
tissue
0.71
cell type or tissue
0.63
interacting protein
0.63


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 199.98   (req: < 5)
Gene RIFs: 5   (req: <= 3)
Antibodies: 139   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 199.98   (req: >= 5)
Gene RIFs: 5   (req: > 3)
Antibodies: 139   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 13
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (33)
ADP signalling through P2Y purinoceptor 12 (R-HSA-392170)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 31
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
ADP signalling through P2Y purinoceptor 12
Reactome
Activation of GABAB receptors
Reactome
Adenylate cyclase inhibitory pathway
Reactome
Chaperonin-mediated protein folding
Reactome
Cooperation of PDCL (PhLP1) and TRiC/CCT in G-protein beta folding
Name
Explore in Pharos
Explore in Source
ADP signalling through P2Y purinoceptor 12
Activation of GABAB receptors
Adenylate cyclase inhibitory pathway
Chaperonin-mediated protein folding
Cooperation of PDCL (PhLP1) and TRiC/CCT in G-protein beta folding
Gene Ontology Terms (21)
Items per page:
10
1 – 5 of 5
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Traceable Author Statement (TAS)
Reactome
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (339)
1 – 10 of 339
GNAI1
Tbio
Novelty: 0.12575547
p_int: 0.999995297
p_ni: 0.000003713
p_wrong: 9.9e-7
Score: 0.93
Data Source: BioPlex,STRINGDB
RAB5C
Tbio
Family: Enzyme
Novelty: 0.05493596
p_int: 0.997214725
p_ni: 0.00019126
p_wrong: 0.002594015
Score: 0.5
Data Source: BioPlex,STRINGDB
TAS1R2
Tbio
Family: GPCR
Novelty: 0.00853435
Score: 0.99
Data Source: STRINGDB
TAS1R3
Tbio
Family: GPCR
Novelty: 0.0050744
Score: 0.99
Data Source: STRINGDB
GNB1
Tbio
Novelty: 0.04716243
Score: 0.984
Data Source: Reactome,STRINGDB
PLCB2
Tbio
Family: Enzyme
Novelty: 0.00689922
Score: 0.982
Data Source: STRINGDB
TAS1R1
Tbio
Family: GPCR
Novelty: 0.0152692
Score: 0.982
Data Source: STRINGDB
TAS2R10
Tbio
Family: GPCR
Novelty: 0.12379073
Score: 0.979
Data Source: STRINGDB
TAS2R4
Tbio
Family: GPCR
Novelty: 0.04115092
Score: 0.979
Data Source: STRINGDB
GNB4
Tbio
Novelty: 0.1530232
Score: 0.978
Data Source: STRINGDB
Publication Statistics
PubMed Score  199.98

PubMed score by year
PubTator Score  17.75

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MGSGISSESKESAKRSKELEKKLQEDAERDARTVKLLLLGAGESGKSTIVKQMKIIHKNGYSEQECMEFK
1-70
AVIYSNTLQSILAIVKAMTTLGIDYVNPRSAEDQRQLYAMANTLEDGGMTPQLAEVIKRLWRDPGIQACF
70-140
ERASEYQLNDSAAYYLNDLDRITASGYVPNEQDVLHSRVKTTGIIETQFSFKDLHFRMFDVGGQRSERKK
140-210
WIHCFEGVTCIIFCAALSAYDMVLVEDEEVNRMHESLHLFNSICNHKYFSTTSIVLFLNKKDIFQEKVTK
210-280
VHLSICFPEYTGPNTFEDAGNYIKNQFLDLNLKKEDKEIYSHMTCATDTQNVKFVFDAVTDIIIKENLKD
280-350
CGLF
350-354
MGSGISSESKESAKRSKELEKKLQEDAERDARTVKLLLLGAGESGKSTIVKQMKIIHKNGYSEQECMEFKAVIYSNTLQSILAIVKAMTTLGIDYVNPRSAEDQRQLYAMANTLEDGGMTPQLAEVIKRLWRDPGIQACFERASEYQLNDSAAYYLNDLDRITASGYVPNEQDVLHSRVKTTGIIETQFSFKDLHFRMFDVGGQRSERKKWIHCFEGVTCIIFCAALSAYDMVLVEDEEVNRMHESLHLFNSICNHKYFSTTSIVLFLNKKDIFQEKVTKVHLSICFPEYTGPNTFEDAGNYIKNQFLDLNLKKEDKEIYSHMTCATDTQNVKFVFDAVTDIIIKENLKDCGLF