You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
DRGX
Dorsal root ganglia homeobox protein

Protein Summary
Description
Transcription factor required for the formation of correct projections from nociceptive sensory neurons to the dorsal horn of the spinal cord and normal perception of pain.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000374139
  • ENSP00000363254
  • ENSG00000165606
  • ENST00000434016
  • ENSP00000401653

Symbol
  • PRRXL1
  • DRG11
  • PRRXL1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0.6
protein domain
0.58
cell line
0.49
cell type or tissue
0.47
chemical
0.41


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 22.75   (req: < 5)
Gene RIFs: 0   (req: <= 3)
Antibodies: 148   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 22.75   (req: >= 5)
Gene RIFs: 0   (req: > 3)
Antibodies: 148   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 9
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein-Protein Interactions (28)
1 – 10 of 28
RGMB
Tbio
Novelty: 0.00152793
Score: 0.814
Data Source: STRINGDB
RGMA
Tbio
Novelty: 0.0034752
Score: 0.812
Data Source: STRINGDB
LEUTX
Tdark
Family: TF
Novelty: 0.38834951
Score: 0.769
Data Source: STRINGDB
ZMAT1
Tdark
Novelty: 2
Score: 0.656
Data Source: STRINGDB
POLR3B
Tbio
Family: Enzyme
Novelty: 0.05095277
Score: 0.642
Data Source: STRINGDB
HJV
Tbio
Novelty: 0.00627463
Score: 0.63
Data Source: STRINGDB
NAGPA
Tbio
Family: Enzyme
Novelty: 0.00835535
Score: 0.626
Data Source: STRINGDB
FAM170B
Tdark
Novelty: 1
Score: 0.554
Data Source: STRINGDB
POU4F1
Tbio
Family: TF
Novelty: 0.006053
Score: 0.551
Data Source: STRINGDB
KCNT2
Tchem
Family: IC
Novelty: 0.00289791
Score: 0.545
Data Source: STRINGDB
Publication Statistics
PubMed Score  22.75

PubMed score by year
PubTator Score  7.42

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MFYFHCPPQLEGTATFGNHSSGDFDDGFLRRKQRRNRTTFTLQQLEALEAVFAQTHYPDVFTREELAMKI
1-70
NLTEARVQVWFQNRRAKWRKTERGASDQEPGAKEPMAEVTPPPVRNINSPPPGDQARSKKEALEAQQSLG
70-140
RTVGPAGPFFPSCLPGTLLNTATYAQALSHVASLKGGPLCSCCVPDPMGLSFLPTYGCQSNRTASVATLR
140-210
MKAREHSEAVLQSANLLPSTSSSPGPVAKPAPPDGSQEKTSPTKEQSEAEKSV
210-263
MFYFHCPPQLEGTATFGNHSSGDFDDGFLRRKQRRNRTTFTLQQLEALEAVFAQTHYPDVFTREELAMKINLTEARVQVWFQNRRAKWRKTERGASDQEPGAKEPMAEVTPPPVRNINSPPPGDQARSKKEALEAQQSLGRTVGPAGPFFPSCLPGTLLNTATYAQALSHVASLKGGPLCSCCVPDPMGLSFLPTYGCQSNRTASVATLRMKAREHSEAVLQSANLLPSTSSSPGPVAKPAPPDGSQEKTSPTKEQSEAEKSV