You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
LILRA5
Leukocyte immunoglobulin-like receptor subfamily A member 5

Protein Classes
Protein Summary
Description
May play a role in triggering innate immune responses. Does not seem to play a role for any class I MHC antigen recognition. The protein encoded by this gene is a member of the leukocyte immunoglobulin-like receptor (LIR) family. LIR family members are known to have activating and inibitory functions in leukocytes. Crosslink of this receptor protein on the surface of monocytes has been shown to induce calcium flux and secretion of several proinflammatory cytokines, which suggests the roles of this protein in triggering innate immune responses. This gene is one of the leukocyte receptor genes that form a gene cluster on the chromosomal region 19q13.4. Four alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000432233
  • ENSP00000404236
  • ENSG00000187116
  • ENST00000486742
  • ENSP00000484372
  • ENST00000611164
  • ENSP00000482658
  • ENSG00000278355
  • ENST00000612266
  • ENSP00000480436
  • ENSG00000274914
  • ENST00000612621
  • ENSP00000484785
  • ENST00000613559
  • ENSP00000484775
  • ENST00000614299
  • ENSP00000483992
  • ENST00000615820
  • ENSP00000480204
  • ENSG00000274113
  • ENST00000616133
  • ENSP00000484062
  • ENSG00000275404
  • ENST00000618711
  • ENSP00000478354
  • ENST00000619516
  • ENSP00000480382
  • ENST00000620091
  • ENSP00000480458
  • ENST00000620692
  • ENSP00000483958
  • ENST00000620898
  • ENSP00000484869
  • ENST00000621042
  • ENSP00000482882
  • ENST00000621482
  • ENSP00000477785

Symbol
  • ILT11
  • LILRB7
  • LIR9
  • CD85
  • LIR9
  • CD85F
  • ILT11
  • LIR-9
  • ILT-11
  • LILRB7
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
tissue sample
0.62
tissue
0.59
cell line
0.57
kinase perturbation
0.54
transcription factor
0.47


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 13.01   (req: < 5)
Gene RIFs: 2   (req: <= 3)
Antibodies: 140   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 13.01   (req: >= 5)
Gene RIFs: 2   (req: > 3)
Antibodies: 140   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 12
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (5)
Adaptive Immune System (R-HSA-1280218)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Adaptive Immune System
Reactome
Immune System
Reactome
Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Name
Explore in Pharos
Explore in Source
Adaptive Immune System
Immune System
Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Protein-Protein Interactions (88)
1 – 10 of 88
HLA-G
Tbio
Novelty: 0.00082058
Score: 0.922
Data Source: STRINGDB
HLA-F
Tbio
Novelty: 0.01349191
Score: 0.921
Data Source: STRINGDB
HLA-E
Tbio
Novelty: 0.00263667
Score: 0.919
Data Source: STRINGDB
HLA-B
Tbio
Novelty: 0.01289492
Score: 0.909
Data Source: STRINGDB
HLA-B
Tbio
Novelty: 0.01289492
Score: 0.909
Data Source: STRINGDB
HLA-B
Tbio
Novelty: 0.01289492
Score: 0.909
Data Source: STRINGDB
HLA-B
Tbio
Novelty: 0.01289492
Score: 0.909
Data Source: STRINGDB
HLA-B
Tbio
Novelty: 0.01289492
Score: 0.909
Data Source: STRINGDB
HLA-B
Tbio
Novelty: 0.01289492
Score: 0.909
Data Source: STRINGDB
HLA-B
Tbio
Novelty: 0.01289492
Score: 0.909
Data Source: STRINGDB
Publication Statistics
PubMed Score  13.01

PubMed score by year
PubTator Score  17.51

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAPWSHPSAQLQPVGGDAVSPALMVLLCLGLSLGPRTHVQAGNLSKATLWAEPGSVISRGNSVTIRCQGT
1-70
LEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEHHAGRYRCYYYSPAGWSEPSDPLELVVTGFYN
70-140
KPTLSALPSPVVTSGENVTLQCGSRLRFDRFILTEEGDHKLSWTLDSQLTPSGQFQALFPVGPVTPSHRW
140-210
MLRCYGSRRHILQVWSEPSDLLEIPVSGAADNLSPSQNKSDSGTASHLQDYAVENLIRMGMAGLILVVLG
210-280
ILIFQDWHSQRSPQAAAGR
280-299
MAPWSHPSAQLQPVGGDAVSPALMVLLCLGLSLGPRTHVQAGNLSKATLWAEPGSVISRGNSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEHHAGRYRCYYYSPAGWSEPSDPLELVVTGFYNKPTLSALPSPVVTSGENVTLQCGSRLRFDRFILTEEGDHKLSWTLDSQLTPSGQFQALFPVGPVTPSHRWMLRCYGSRRHILQVWSEPSDLLEIPVSGAADNLSPSQNKSDSGTASHLQDYAVENLIRMGMAGLILVVLGILIFQDWHSQRSPQAAAGR