You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
HTR3E
5-hydroxytryptamine receptor 3E

Protein Summary
Description
This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor is a ligand-gated ion channel, which when activated causes fast, depolarizing responses. It is a cation-specific, but otherwise relatively nonselective, ion channel. This locus encodes a 5-hydroxytryptamine (serotonin) receptor subunit. The encoded protein, subunit E, may play a role in neurotransmission in myenteric neurons. Genes encoding subunits C, D and E form a cluster on chromosome 3. Alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq, Feb 2012]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000335304
  • ENSP00000335511
  • ENSG00000186038
  • ENST00000415389
  • ENSP00000401444
  • ENST00000425359
  • ENSP00000401900
  • ENST00000436361
  • ENSP00000395833
  • ENST00000440596
  • ENSP00000406050

Symbol
  • 5-HT3E
  • 5-HT3-E
  • 5-HT3c1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
0.76
protein domain
0.73
cell line
0.63
phenotype
0.58
disease
0.43


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 7.22   (req: < 5)
Gene RIFs: 9   (req: <= 3)
Antibodies: 116   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 7.22   (req: >= 5)
Gene RIFs: 9   (req: > 3)
Antibodies: 116   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 7
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 2
Pathways (5)
Neuronal System (R-HSA-112316)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Neuronal System
Reactome
Neurotransmitter receptors and postsynaptic signal transmission
Reactome
Transmission across Chemical Synapses
Name
Explore in Pharos
Explore in Source
Neuronal System
Neurotransmitter receptors and postsynaptic signal transmission
Transmission across Chemical Synapses
Protein-Protein Interactions (23)
1 – 10 of 23
ARL6IP5
Tbio
Novelty: 0.01272626
p_int: 0.997005786
p_ni: 0.002994214
Score: 0.187
Data Source: BioPlex,STRINGDB
ATP2A3
Tbio
Family: Transporter
Novelty: 0.01101086
p_int: 0.994902272
p_ni: 0.005097728
Score: 0.207
Data Source: BioPlex,STRINGDB
AMFR
Tbio
Family: Enzyme
Novelty: 0.00344903
p_int: 0.850492146
p_ni: 0.149507854
Score: 0.455
Data Source: BioPlex,STRINGDB
HTR3A
Tclin
Family: IC
Novelty: 0.00035394
Score: 0.939
Data Source: Reactome,STRINGDB
HTR7
Tclin
Family: GPCR
Novelty: 0.00190476
Score: 0.549
Data Source: STRINGDB
ZNF491
Tdark
Family: TF
Score: 0.529
Data Source: STRINGDB
HTR5A
Tchem
Family: GPCR
Novelty: 0.01826019
Score: 0.528
Data Source: STRINGDB
SNCA
Tchem
Novelty: 0.00021357
Score: 0.501
Data Source: STRINGDB
HTR1B
Tclin
Family: GPCR
Novelty: 0.00089155
Score: 0.484
Data Source: STRINGDB
HTR2A
Tclin
Family: GPCR
Novelty: 0.00043879
Score: 0.48
Data Source: STRINGDB
Publication Statistics
PubMed Score  7.22

PubMed score by year
PubTator Score  8.67

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MEGSWFHRKRFSFYLLLGFLLQGRGVTFTINCSGFGQHGADPTALNSVFNRKPFRPVTNISVPTQVNISF
1-70
AMSAILDVNEQLHLLSSFLWLEMVWDNPFISWNPEECEGITKMSMAAKNLWLPDIFIIELMDVDKTPKGL
70-140
TAYVSNEGRIRYKKPMKVDSICNLDIFYFPFDQQNCTLTFSSFLYTVDSMLLDMEKEVWEITDASRNILQ
140-210
THGEWELLGLSKATAKLSRGGNLYDQIVFYVAIRRRPSLYVINLLVPSGFLVAIDALSFYLPVKSGNRVP
210-280
FKITLLLGYNVFLLMMSDLLPTSGTPLIGVYFALCLSLMVGSLLETIFITHLLHVATTQPPPLPRWLHSL
280-350
LLHCNSPGRCCPTAPQKENKGPGLTPTHLPGVKEPEVSAGQMPGPAEAELTGGSEWTRAQREHEAQKQHS
350-420
VELWLQFSHAMDAMLFRLYLLFMASSIITVICLWNT
420-456
MEGSWFHRKRFSFYLLLGFLLQGRGVTFTINCSGFGQHGADPTALNSVFNRKPFRPVTNISVPTQVNISFAMSAILDVNEQLHLLSSFLWLEMVWDNPFISWNPEECEGITKMSMAAKNLWLPDIFIIELMDVDKTPKGLTAYVSNEGRIRYKKPMKVDSICNLDIFYFPFDQQNCTLTFSSFLYTVDSMLLDMEKEVWEITDASRNILQTHGEWELLGLSKATAKLSRGGNLYDQIVFYVAIRRRPSLYVINLLVPSGFLVAIDALSFYLPVKSGNRVPFKITLLLGYNVFLLMMSDLLPTSGTPLIGVYFALCLSLMVGSLLETIFITHLLHVATTQPPPLPRWLHSLLLHCNSPGRCCPTAPQKENKGPGLTPTHLPGVKEPEVSAGQMPGPAEAELTGGSEWTRAQREHEAQKQHSVELWLQFSHAMDAMLFRLYLLFMASSIITVICLWNT