You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
RBM47
RNA-binding protein 47

IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 18.3   (req: < 5)
Gene RIFs: 5   (req: <= 3)
Antibodies: 40   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 18.3   (req: >= 5)
Gene RIFs: 5   (req: > 3)
Antibodies: 40   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 3
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Gene Ontology Terms (4)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from High Throughput Direct Assay (HDA)
UniProtKB
Protein-Protein Interactions (74)
1 – 10 of 74
MB21D2
Tdark
Novelty: 12
p_int: 0.999999976
p_ni: 2.4e-8
Data Source: BioPlex
RBM46
Tbio
Novelty: 0.06568658
p_int: 0.999999975
p_wrong: 2.5e-8
Data Source: BioPlex
RBMXL1
Tdark
Novelty: 0.94240838
p_int: 0.999469831
p_ni: 0.000530169
Data Source: BioPlex
RPS27A
Tbio
Novelty: 0.01148413
p_int: 0.996779232
p_ni: 0.003220754
p_wrong: 1.4e-8
Data Source: BioPlex
TRUB2
Tdark
Family: Enzyme
Novelty: 0.85714286
p_int: 0.992544788
p_ni: 0.007455212
Data Source: BioPlex
ELAVL2
Tbio
Novelty: 0.0071859
p_int: 0.985348146
p_ni: 0.014650459
p_wrong: 0.000001395
Data Source: BioPlex
YTHDC1
Tbio
Novelty: 0.02979921
p_int: 0.981208727
p_ni: 0.018791248
p_wrong: 2.6e-8
Data Source: BioPlex
MTERF3
Tdark
Novelty: 0.07686676
p_int: 0.979678521
p_ni: 0.020321479
Data Source: BioPlex
HERC5
Tbio
Family: Enzyme
Novelty: 0.02247232
p_int: 0.978266812
p_ni: 0.021733187
Data Source: BioPlex
FASTKD2
Tbio
Family: Enzyme
Novelty: 0.15286624
p_int: 0.96434524
p_ni: 0.03565476
Data Source: BioPlex
Publication Statistics
PubMed Score  18.30

PubMed score by year
PubTator Score  5.19

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MTAEDSTAAMSSDSAAGSSAKVPEGVAGAPNEAALLALMERTGYSMVQENGQRKYGGPPPGWEGPHPQRG
1-70
CEVFVGKIPRDVYEDELVPVFEAVGRIYELRLMMDFDGKNRGYAFVMYCHKHEAKRAVRELNNYEIRPGR
70-140
LLGVCCSVDNCRLFIGGIPKMKKREEILEEIAKVTEGVLDVIVYASAADKMKNRGFAFVEYESHRAAAMA
140-210
RRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIETTEDTIKKSFGQFNPGCVERVKKI
210-280
RDYAFVHFTSREDAVHAMNNLNGTELEGSCLEVTLAKPVDKEQYSRYQKAARGGGAAEAAQQPSYVYSCD
280-350
PYTLAYYGYPYNALIGPNRDYFVKAGSIRGRGRGAAGNRAPGPRGSYLGGYSAGRGIYSRYHEGKGKQQE
350-420
KGYELVPNLEIPTVNPVAIKPGTVAIPAIGAQYSMFPAAPAPKMIEDGKIHTVEHMISPIAVQPDPASAA
420-490
AAAAAAAAAAAAVIPTVSTPPPFQGRPITPVYTVAPNVQRIPTAGIYGASYVPFAAPATATIATLQKNAA
490-560
AAAAMYGGYAGYIPQAFPAAAIQVPIPDVYQTY
560-593
MTAEDSTAAMSSDSAAGSSAKVPEGVAGAPNEAALLALMERTGYSMVQENGQRKYGGPPPGWEGPHPQRGCEVFVGKIPRDVYEDELVPVFEAVGRIYELRLMMDFDGKNRGYAFVMYCHKHEAKRAVRELNNYEIRPGRLLGVCCSVDNCRLFIGGIPKMKKREEILEEIAKVTEGVLDVIVYASAADKMKNRGFAFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIETTEDTIKKSFGQFNPGCVERVKKIRDYAFVHFTSREDAVHAMNNLNGTELEGSCLEVTLAKPVDKEQYSRYQKAARGGGAAEAAQQPSYVYSCDPYTLAYYGYPYNALIGPNRDYFVKAGSIRGRGRGAAGNRAPGPRGSYLGGYSAGRGIYSRYHEGKGKQQEKGYELVPNLEIPTVNPVAIKPGTVAIPAIGAQYSMFPAAPAPKMIEDGKIHTVEHMISPIAVQPDPASAAAAAAAAAAAAAAVIPTVSTPPPFQGRPITPVYTVAPNVQRIPTAGIYGASYVPFAAPATATIATLQKNAAAAAAMYGGYAGYIPQAFPAAAIQVPIPDVYQTY