Property Summary

NCBI Gene PubMed Count 9
PubMed Score 2.55
PubTator Score 2.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
juvenile dermatomyositis 1187 6.4e-11
lung cancer 4740 9.2e-04
osteosarcoma 7950 1.5e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Acquired metabolic disease 336 0.0 3.0

Expression

  Differential Expression (3)

Disease log2 FC p
juvenile dermatomyositis 1.193 6.4e-11
lung cancer 1.100 9.2e-04
osteosarcoma 1.163 1.5e-02

AA Sequence

MAASRSTRVTRSTVGLNGLDESFCGRTLRNRSIAHPEEISSNSQVRSRSPKKRPEPVPIQKGNNNGRTTD      1 - 70
LKQQSTRESWVSPRKRGLSSSEKDNIERQAIENCERRQTEPVSPVLKRIKRCLRSEAPNSSEEDSPIKSD     71 - 140
KESVEQRSTVVDNDADFQGTKRACRCLILDDCEKREIKKVNVSEEGPLNSAVVEEITGYLAVNGVDDSDS    141 - 210
AVINCDDCQPDGNTKQNSIGSYVLQEKSVAENGDTDTQTSMFLDSRKEDSYIDHKVPCTDSQVQVKLEDH    211 - 280
KIVTACLPVEHVNQLTTEPATGPFSETQSSLRDSEEEVDVVGDSSASKEQCKENTNNELDTSLESMPASG    281 - 350
EPEPSPVLDCVSAQMMSLSEPQEHRYTLRTSPRRAAPTRGSPTKNSSPYRENGQFEENNLSPNETNATVS    351 - 420
DNVSQSPTNPGEISQNEKGICCDSQNNGSEGVSKPPSEARLNIGHLPSAKESASQHITEEEDDDPDVYYF    421 - 490
ESDHVALKHNKDYQRLLQTIAVLEAQRSQAVQDLESLGRHQREALKNPIGFVEKLQKKADIGLPYPQRVV    491 - 560
QLPEIVWDQYTHSLGNFEREFKNRKRHTRRVKLVFDKVGLPARPKSPLDPKKDGESLSYSMLPLSDGPEG    561 - 630
SSSRPQMIRGRLCDDTKPETFNQLWTVEEQKKLEQLLIKYPPEEVESRRWQKIADELGNRTAKQVASRVQ    631 - 700
KYFIKLTKAGIPVPGRTPNLYIYSKKSSTSRRQHPLNKHLFKPSTFMTSHEPPVYMDEDDDRSCFHSHMN    701 - 770
TAVEDASDDESIPIMYRNLPEYKELLQFKKLKKQKLQQMQAESGFVQHVGFKCDNCGIEPIQGVRWHCQD    771 - 840
CPPEMSLDFCDSCSDCLHETDIHKEDHQLEPIYRSETFLDRDYCVSQGTSYNYLDPNYFPANR           841 - 903
//

Text Mined References (21)

PMID Year Title