Property Summary

NCBI Gene PubMed Count 65
PubMed Score 159.25
PubTator Score 85.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
ependymoma 1.200 4.2e-03
glioblastoma 2.900 3.5e-06
osteosarcoma -1.135 1.7e-02
cystic fibrosis -1.194 2.6e-04
astrocytoma 1.400 1.2e-03
non diabetic and post-ischemic heart fai... -1.200 2.1e-03
atypical teratoid / rhabdoid tumor 2.200 1.5e-06
medulloblastoma 1.200 5.0e-03
primitive neuroectodermal tumor 1.100 2.3e-02
primary pancreatic ductal adenocarcinoma 1.352 1.3e-02
lung cancer -1.300 5.6e-03
pediatric high grade glioma 2.200 6.1e-06
pilocytic astrocytoma 1.400 1.1e-03
lung carcinoma -2.200 1.3e-42
gastric carcinoma 1.900 2.8e-02
ovarian cancer 1.700 2.2e-04
pancreatic cancer 1.100 2.2e-02

Protein-protein Interaction (10)

Gene RIF (31)

PMID Text
27125030 Zyxin binding to Ptc2 is due to the interaction of Zyxin 2nd LIM-domain (530-590 aa) with the under-membrane region of the cytoplasmic C-terminus of Ptc2 (1159-1412 aa).
26611125 VASP, zyxin and TES are tension-dependent members of focal adherens junctions independent of the alpha-catenin-vinculin module.
26071033 key regulator of stretch-induced gene expression at the cellular level
25771989 ZYX gene may be aging-related gene and involved in Osteoporosis.
25038525 Matrix density alters zyxin phosphorylation, which limits peripheral process formation and extension in endothelial cells invading 3D collagen matrices.
25025691 Zyxin, which is thought to be essential for tight cell-to-cell junctions, decreased 1.8-fold in TNF-alpha-treated human brain microvascular endothelial cells.
24036928 Integrin-beta5 and zyxin mediate formation of ventral stress fibers in response to transforming growth factor beta.
23330981 Zyxin is a novel target for beta-amyloid peptide activities in Alzheimer's disease.
23321499 RA-induced cancer cell cytotoxicity was significantly impaired by Zyxin or PTOV1. Overall, our findings suggest that Zyxin and PTOV1 should be considered as critical determinants in cancer therapy with retinoids
23292068 Zyxin is suggested to promote growth, migration and invasiveness of fibroblastic type oral squamous cell carcinoma cells by upregulating Rac1 and Cdc42.
23233529 A stretch-induced signaling pathway in vascular cells leads to the activation of zyxin, a cytoskeletal protein specifically involved in transducing mechanical stimuli.
22778267 Zyxin is a transforming growth factor-beta (TGF-beta)/Smad3 target gene that regulates lung cancer cell motility via integrin alpha5beta1.
22721673 Yeast two hybrid assay identifies the HIV-1 Nef-interacting protein zyxin. HIV-1 Nef co-localizes with zyxin in the cortical regions of human podocyte
22395610 Zyxin phenotype is mediated by partners alpha-actinin and p130Cas and ensures that motile cells in a three-dimensional matrix explore the largest space possible in minimum time.
22056563 Depletion of nectin-2 from L cells expressing E-cadherin results in a loss of zyxin localization to cell-cell contacts, demonstrating that the zyxin-nectin interaction plays a critical role in zyxin targeting to these sites.
21889443 LIM domain of zyxin recruits zyxin to force-bearing sites at the leading edge of migrating cells
21486952 When myosin II contractility was inhibited, the k(off) values for all three proteins changed rapidly, in a highly protein-specific manner: dissociation of vinculin from FAs was facilitated, whereas dissociation of paxillin and zyxin was attenuated.
21360639 Zyxin, whose expression is negatively regulated by microRNA-16 (miR-16), is confirmed to be a direct target gene of miR-16. Overexpression of zyxin could also restrain cell movement and enhance cell-cell adhesion.
21248071 Findings suggest an unforeseen role for Zyxin in DNA damage-induced cell fate control through modulating the HIPK2-p53 signaling axis.
20705921 Stretch appears to be an important factor in the development of endothelial dysfunction with zyxin as a potential therapeutic target to interfere with these early changes in endothelial cell phenotype
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19853601 The LIM domain protein zyxin was identified as an interaction partner for human synemin.
19690217 This study establishes a crucial role of zyxin in thrombin signaling in endothelial cells and provides evidence for a novel PAR-1 signaling pathway mediated by zyxin.
18854154 Knockdown of zyxin (ZYX) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
18682496 These results suggest that zyxin is involved in mechanical-force-dependent facilitation of actin polymerization at focal adhesions.
16956606 A sarch for genes upregulated by thymosin beta4 identified zyxin in SiHA cells in the presence of exogenously added thymosin beta4 and when thymosin beta4 is overexpressed using adenoviral vectors.
16510139 zyxin indirectly enables the interaction of ZNF384/CIZ/NMP4 with p130CAS
15748890 Within Ewing tumor cells, zyxin is expressed at very low levels and remains diffusely distributed throughout the cytoplasm, instead of concentrating in actin-rich dynamic structures. Zyxin has tumor suppressor activity in Ewing tumor cells.
15084601 We identified zyxin as an interactor with endoglin in human umbilical vein vascular endothelial cells and this interaction is localized within the 47-amino acid carboxyl-terminal cytosolic domain of endoglin, and maps within zyxin residues 326-572.
15004028 LIM-nebulette, Lasp-1, and zyxin may play an important role in the organization of focal adhesions

AA Sequence

MAAPRPSPAISVSVSAPAFYAPQKKFGPVVAPKPKVNPFRPGDSEPPPAPGAQRAQMGRVGEIPPPPPED      1 - 70
FPLPPPPLAGDGDDAEGALGGAFPPPPPPIEESFPPAPLEEEIFPSPPPPPEEEGGPEAPIPPPPQPREK     71 - 140
VSSIDLEIDSLSSLLDDMTKNDPFKARVSSGYVPPPVATPFSSKSSTKPAAGGTAPLPPWKSPSSSQPLP    141 - 210
QVPAPAQSQTQFHVQPQPQPKPQVQLHVQSQTQPVSLANTQPRGPPASSPAPAPKFSPVTPKFTPVASKF    211 - 280
SPGAPGGSGSQPNQKLGHPEALSAGTGSPQPPSFTYAQQREKPRVQEKQHPVPPPAQNQNQVRSPGAPGP    281 - 350
LTLKEVEELEQLTQQLMQDMEHPQRQNVAVNELCGRCHQPLARAQPAVRALGQLFHIACFTCHQCAQQLQ    351 - 420
GQQFYSLEGAPYCEGCYTDTLEKCNTCGEPITDRMLRATGKAYHPHCFTCVVCARPLEGTSFIVDQANRP    421 - 490
HCVPDYHKQYAPRCSVCSEPIMPEPGRDETVRVVALDKNFHMKCYKCEDCGKPLSIEADDNGCFPLDGHV    491 - 560
LCRKCHTARAQT                                                              561 - 572
//

Text Mined References (82)

PMID Year Title
27125030 [The Cytoskelrtal Protein Zvxin Interacts with the Hedgehog Receptor Patched].
26611125 2015 VASP, zyxin and TES are tension-dependent members of Focal Adherens Junctions independent of the ?-catenin-vinculin module.
26071033 2015 Loss of the mechanotransducer zyxin promotes a synthetic phenotype of vascular smooth muscle cells.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25771989 2015 Comprehensive transcriptome analysis of mesenchymal stem cells in elderly patients with osteoporosis.
25416956 2014 A proteome-scale map of the human interactome network.
25038525 2014 Matrix density alters zyxin phosphorylation, which limits peripheral process formation and extension in endothelial cells invading 3D collagen matrices.
25025691 2014 Zyxin modulates the transmigration of Haemophilus influenzae to the central nervous system.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
24036928 2013 Integrin-?5 and zyxin mediate formation of ventral stress fibers in response to transforming growth factor ?.
23840749 2013 MOR is not enough: identification of novel mu-opioid receptor interacting proteins using traditional and modified membrane yeast two-hybrid screens.
23330981 2013 Zyxin is a novel target for ?-amyloid peptide: characterization of its role in Alzheimer's pathogenesis.
23321499 2013 Zyxin cooperates with PTOV1 to confer retinoic acid resistance by repressing RAR activity.
23292068 2013 Functional analysis of Zyxin in cell migration and invasive potential of oral squamous cell carcinoma cells.
23233529 2012 Mechanism of stretch-induced activation of the mechanotransducer zyxin in vascular cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22778267 2012 Zyxin is a transforming growth factor-? (TGF-?)/Smad3 target gene that regulates lung cancer cell motility via integrin ?5?1.
22665060 2013 Nuclear import of LASP-1 is regulated by phosphorylation and dynamic protein-protein interactions.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22395610 2012 Dimensional and temporal controls of three-dimensional cell migration by zyxin and binding partners.
22056563 2011 A zyxin-nectin interaction facilitates zyxin localization to cell-cell adhesions.
21889443 2011 The LIM domain of zyxin is sufficient for force-induced accumulation of zyxin during cell migration.
21486952 2011 Actomyosin-generated tension controls the molecular kinetics of focal adhesions.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21360639 2011 MicroRNA-16 targets zyxin and promotes cell motility in human laryngeal carcinoma cell line HEp-2.
21269460 2011 Initial characterization of the human central proteome.
21248071 2011 Zyxin is a critical regulator of the apoptotic HIPK2-p53 signaling axis.
20705921 2010 Zyxin mediation of stretch-induced gene expression in human endothelial cells.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19853601 2010 Synemin interacts with the LIM domain protein zyxin and is essential for cell adhesion and migration.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19690217 2009 Zyxin is involved in thrombin signaling via interaction with PAR-1 receptor.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18682496 2008 Mechanical forces facilitate actin polymerization at focal adhesions in a zyxin-dependent manner.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18297730 2008 The LIM-domain protein Zyxin binds the homeodomain factor Xanf1/Hesx1 and modulates its activity in the anterior neural plate of Xenopus laevis embryo.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18158903 2007 Tes, a specific Mena interacting partner, breaks the rules for EVH1 binding.
18088087 2008 Phosphoproteome of resting human platelets.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17924679 2007 Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16956606 2006 Zyxin is upregulated in the nucleus by thymosin beta4 in SiHa cells.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16510139 2006 Interaction partners for human ZNF384/CIZ/NMP4--zyxin as a mediator for p130CAS signaling?
15748890 2005 The actin cytoskeleton-associated protein zyxin acts as a tumor suppressor in Ewing tumor cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15084601 2004 Endoglin controls cell migration and composition of focal adhesions: function of the cytosolic domain.
15004028 2004 Zyxin interacts with the SH3 domains of the cytoskeletal proteins LIM-nebulette and Lasp-1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12695497 2003 The conformational state of Tes regulates its zyxin-dependent recruitment to focal adhesions.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12417594 2003 The LIM protein Ajuba is recruited to cadherin-dependent cell junctions through an association with alpha-catenin.
11841540 2002 Role of zyxin in differential cell spreading and proliferation of melanoma cells and melanocytes.
11782456 2002 Members of the Zyxin family of LIM proteins interact with members of the p130Cas family of signal transducers.
11689660 2001 Interaction of zyxin, a focal adhesion protein, with the e6 protein from human papillomavirus type 6 results in its nuclear translocation.
11423549 2001 Analysis of the alpha-actinin/zyxin interaction.
10978534 2000 BSPRY, a novel protein of the Ro-Ret family.
10882740 2000 Phosphorylation of the vasodilator-stimulated phosphoprotein regulates its interaction with actin.
10851246 2000 Regulation of human endothelial cell focal adhesion sites and migration by cGMP-dependent protein kinase I.
10831611 2000 Zyxin, a regulator of actin filament assembly, targets the mitotic apparatus by interacting with h-warts/LATS1 tumor suppressor.
10801818 2000 Characterization of the interaction between zyxin and members of the Ena/vasodilator-stimulated phosphoprotein family of proteins.
10224105 1999 An alpha-actinin binding site of zyxin is essential for subcellular zyxin localization and alpha-actinin recruitment.
9784834 1998 Gene encoding a human testis Sertoli cell component related to LIM domain protein.
9730620 1998 Assignment of the ZYX gene for the LIM protein zyxin to human chromosome bands 7q34-->q35 by in situ hybridization.
9367993 1997 Noc2, a putative zinc finger protein involved in exocytosis in endocrine cells.
8940160 1996 Molecular characterization of human zyxin.
8917469 1996 A zyxin-related protein whose synthesis is reduced in virally transformed fibroblasts.
8622875 1996 SH3 domain-dependent interaction of the proto-oncogene product Vav with the focal contact protein zyxin.
7696985 1994 Gene encoding a mammalian epididymal protein.
7644520 1995 Identification, purification, and characterization of a zyxin-related protein that binds the focal adhesion and microfilament protein VASP (vasodilator-stimulated phosphoprotein).