Property Summary

NCBI Gene PubMed Count 7
PubMed Score 8.19
PubTator Score 3.31

Knowledge Summary


No data available


  Differential Expression (26)

Disease log2 FC p
astrocytic glioma -1.300 7.5e-03
ependymoma -1.100 3.4e-02
oligodendroglioma -1.300 7.7e-03
psoriasis 1.500 8.6e-12
osteosarcoma 2.539 4.3e-04
medulloblastoma 1.900 2.5e-08
atypical teratoid / rhabdoid tumor 1.500 1.6e-05
glioblastoma 1.700 1.1e-04
medulloblastoma, large-cell 2.500 3.0e-05
primitive neuroectodermal tumor 1.800 1.0e-04
adrenocortical carcinoma 1.976 5.8e-05
tuberculosis and treatment for 3 months -1.100 4.9e-04
non-small cell lung cancer 1.858 3.2e-17
intraductal papillary-mucinous carcinoma... 1.400 3.0e-03
intraductal papillary-mucinous neoplasm ... 1.500 1.2e-02
lung cancer 1.800 9.1e-05
Breast cancer 3.300 2.7e-02
pediatric high grade glioma 1.500 1.0e-04
nasopharyngeal carcinoma 1.200 3.5e-04
breast carcinoma 1.100 6.7e-28
Alzheimer's disease -1.100 4.7e-02
Pick disease -1.600 2.6e-05
ductal carcinoma in situ 1.200 8.5e-05
invasive ductal carcinoma 1.500 8.4e-04
ulcerative colitis 1.100 6.9e-05
ovarian cancer 2.300 7.7e-05

Protein-protein Interaction (3)

Gene RIF (3)

20800603 Observational study of gene-disease association. (HuGE Navigator)
19008095 Observational study of gene-disease association. (HuGE Navigator)
12686595 Other name: HZwilch. Homologue of Drosophila Zwilch (CG18729). Localizes to the kinetochore during prometaphase and metaphase of HeLa cells. Complexed with human ROD and human ZW10, similar to situation in Drosophila.

AA Sequence

KPDFSELTLNGSLEERIFFTNMVTCSQVHFK                                           561 - 591

Text Mined References (14)

PMID Year Title
21269460 2011 Initial characterization of the human central proteome.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20462495 2010 Structural analysis of the RZZ complex reveals common ancestry with multisubunit vesicle tethering machinery.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19008095 2009 Single nucleotide polymorphisms in chromosomal instability genes and risk and clinical outcome of breast cancer: a Swedish prospective case-control study.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15824131 2005 ZW10 links mitotic checkpoint signaling to the structural kinetochore.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15126332 2004 Three classes of genes mutated in colorectal cancers with chromosomal instability.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12686595 2003 Zwilch, a new component of the ZW10/ROD complex required for kinetochore functions.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.