Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.63
PubTator Score 4.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma -1.400 1.7e-02
colon cancer -1.300 4.6e-03
cystic fibrosis -1.700 2.8e-05
lung cancer 1.900 6.6e-04
malignant mesothelioma -2.100 2.1e-07
ovarian cancer -1.600 3.8e-05
pituitary cancer -1.200 2.0e-05

Gene RIF (3)

AA Sequence

MASTEEQYDLKIVKVEEDPIWDQETHLRGNNFSGQEASRQLFRQFCYQETPGPREALSRLRELCHQWLRP      1 - 70
EIHTKEQILELLVLEQFLTILPEELQAWVREHHPESGEEAVAVVEDLEQELSEPGNQAPDHEHGHSEVLL     71 - 140
EDVEHLKVKQEPTDIQLQPMVTQLRYESFCLHQFQEQDGESIPENQELASKQEILKEMEHLGDSKLQRDV    141 - 210
SLDSKYRETCKRDSKAEKQQAHSTGERRHRCNECGKSFTKSSVLIEHQRIHTGEKPYECEECGKAFSRRS    211 - 280
SLNEHRRSHTGEKPYQCKECGKAFSASNGLTRHRRIHTGEKPYECKVCGKAFLLSSCLVQHQRIHTGEKR    281 - 350
YQCRECGKAFIQNAGLFQHLRVHTGEKPYQCSQCSKLFSKRTLLKKHQKIHTGERP                  351 - 406
//

Text Mined References (15)

PMID Year Title