Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.23
PubTator Score 0.08

Knowledge Summary


No data available


  Disease (1)

Disease Target Count P-value
non primary Sjogren syndrome sicca 840 2.6e-02


  Differential Expression (1)

Disease log2 FC p
non primary Sjogren syndrome sicca -1.100 2.6e-02


Accession Q3MJ62 Q96KV9
Symbols ZNF390


PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

HQRIHTGERPYECEECGKNFIYHCNLIQHRKVHPVAESS                                   351 - 389

Text Mined References (5)

PMID Year Title
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.